Details for Arabidopsis Locus AT3G05725

Position : Chr3 ( 5`- 1692510 .. 1693330 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05725

Protein [Map View]
MEEFQSPRIRSYKSYEGDRNLQLVNPADLKLVRGIYVVRESRRNRSPIKTDIWRKMSYKDMPVRPRRSSSHSTLFKGWWN
DPEIKRKRRVAKYKLYSAEGKMKITLRKSYKWIKIQCSKIIHGI*

DNA
ATGGAGGAATTCCAATCTCCTAGAATACGATCTTACAAATCGTATGAAGGAGATAGGAACCTCCAACTGGTTAATCCTGC
AGATTTAAAACTGGTCAGAGGGATATATGTTGTTAGAGAATCGAGGCGCAATCGATCTCCGATAAAAACAGATATATGGC
GCAAGATGTCTTACAAAGACATGCCCGTTAGACCGAGAAGATCTTCTTCTCATTCGACATTGTTCAAAGGATGGTGGAAC
GATCCGGAGATAAAGAGAAAGAGACGAGTGGCGAAATACAAACTCTATTCAGCCGAAGGGAAGATGAAGATAACTTTGAG
AAAGAGTTACAAATGGATTAAGATCCAATGCTCGAAGATCATTCATGGAATATAG