Details for Arabidopsis Locus AT3G05710

Position : Chr3 ( 5`- 1684996 .. 1687558 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05710

Protein [Map View]
MATRNRTLLFRKYRNSLRSVRAPMGSSSSSTLTEHNSLTGAKSGLGPVIEMASTSLLNPNRSYAPVSTEDPGNSSRGTIT
VGLPPDWVDVSEEISVYIQRARTKMAELGKAHAKALMPSFGDGKEDQHQIETLTQEVTFLLKKSEKQLQRLSAAGPSEDS
NVRKNVQRSLATDLQNLSMELRKKQSTYLKRLRLQKEDGADLEMNLNGSRYKAEDDDFDDMVFSEHQMSKIKKSEEISIE
REKEIQQVVESVSELAQIMKDLSALVIDQGTIVDRIDYNIQNVASTVDDGLKQLQKAERTQRQGGMVMCASVLVILCFIM
LVLLILKEILL*

DNA
ATGGCGACTAGGAATCGTACGCTGTTGTTTAGGAAGTACAGAAACTCTCTCAGGAGCGTTCGTGCTCCAATGGGGTCGTC
TTCGTCGTCGACATTGACGGAGCACAATTCGTTGACCGGAGCTAAATCCGGATTAGGCCCGGTGATCGAGATGGCGAGCA
CGTCTCTATTGAATCCAAATCGGTCTTATGCTCCAGTCAGTACCGAGGATCCTGGGAATTCGAGTAGAGGTACAATAACA
GTGGGCTTACCACCAGATTGGGTTGATGTATCTGAGGAGATTTCAGTTTACATTCAACGTGCAAGAACCAAAATGGCTGA
ATTGGGAAAGGCTCATGCGAAAGCGTTGATGCCTTCGTTTGGGGATGGTAAAGAAGATCAACATCAAATCGAGACTTTGA
CACAAGAGGTTACCTTCCTATTGAAGAAATCTGAGAAGCAACTTCAGAGGCTTTCTGCAGCTGGACCTTCTGAAGATTCA
AATGTCAGGAAAAACGTCCAGCGATCTCTTGCTACGGATCTCCAAAACCTTTCTATGGAGTTACGCAAGAAACAGTCTAC
ATATTTGAAACGTTTGAGACTACAAAAAGAGGATGGAGCGGATTTAGAGATGAATCTGAACGGAAGCAGATATAAAGCAG
AAGATGATGACTTTGATGATATGGTATTTAGTGAGCATCAAATGAGCAAGATAAAAAAGAGTGAGGAAATATCAATAGAG
AGGGAGAAAGAGATTCAACAGGTTGTTGAATCCGTAAGCGAGCTTGCTCAGATCATGAAGGATCTGTCAGCGCTTGTGAT
AGACCAGGGTACAATAGTTGATCGGATTGACTATAATATCCAGAACGTTGCTAGTACAGTCGACGATGGTCTCAAACAGC
TGCAAAAGGCGGAACGTACACAGAGACAAGGAGGTATGGTGATGTGTGCGTCTGTTCTTGTCATTCTCTGCTTCATCATG
CTGGTACTCTTAATCCTCAAGGAGATTCTGTTGTGA