Details for Arabidopsis Locus AT3G05690

Position : Chr3 ( 5`- 1676546 .. 1678932 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05690

Protein [Map View]
MAMQTVREGLFSAPQTSWWTAFGSQPLAPESLAGDSDSFAGVKVGSVGETGQRVDKQSNSATHLAFSLGDVKSPRLVPKP
HGATFSMQSPCLELGFSQPPIYTKYPYGEQQYYGVVSAYGSQSRVMLPLNMETEDSTIYVNSKQYHGIIRRRQSRAKAAA
VLDQKKLSSRCRKPYMHHSRHLHALRRPRGSGGRFLNTKSQNLENSGTNAKKGDGSMQIQSQPKPQQSNSQNSEVVHPEN
GTMNLSNGLNVSGSEVTSMNYFLSSPVHSLGGMVMPSKWIAAAAAMDNGCCNFKT*

DNA
ATGGCTATGCAAACTGTGAGAGAAGGTCTCTTCTCTGCTCCACAGACTTCTTGGTGGACTGCTTTTGGATCTCAGCCGTT
GGCTCCGGAGAGTCTCGCCGGCGATTCTGACTCATTCGCCGGAGTTAAGGTCGGATCTGTCGGAGAGACAGGACAACGTG
TGGATAAACAGAGCAACTCTGCAACGCACTTAGCTTTCTCACTTGGTGATGTAAAGAGTCCAAGACTTGTGCCAAAGCCT
CATGGAGCTACTTTCTCAATGCAATCACCTTGCTTGGAACTTGGATTTTCTCAGCCACCGATCTATACAAAGTATCCCTA
TGGAGAACAACAATACTATGGAGTTGTTTCAGCCTATGGATCTCAGAGCAGGGTAATGCTTCCTCTAAACATGGAAACGG
AAGATAGTACCATCTATGTGAACTCAAAGCAATACCATGGAATCATAAGGAGACGCCAATCCCGCGCAAAGGCTGCTGCT
GTTCTTGATCAGAAGAAATTGAGTAGTAGATGCCGCAAGCCATATATGCATCATTCGCGCCATCTCCATGCATTGCGGCG
TCCTAGAGGATCCGGTGGGAGATTCTTGAACACTAAAAGTCAGAACTTGGAAAATAGCGGAACCAATGCAAAGAAAGGTG
ATGGAAGTATGCAGATTCAGTCTCAGCCTAAGCCTCAGCAAAGTAACTCTCAGAATTCTGAAGTTGTTCATCCGGAAAAC
GGGACCATGAACTTATCGAACGGATTAAATGTGTCGGGATCAGAAGTTACTAGCATGAACTACTTCCTAAGTTCTCCCGT
TCATTCTCTTGGTGGCATGGTAATGCCTAGCAAGTGGATAGCAGCAGCAGCAGCAATGGATAATGGCTGCTGCAATTTCA
AAACCTGA