Details for Arabidopsis Locus AT3G05685

Position : Chr3 ( 5`- 1673780 .. 1674908 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05685

Protein [Map View]
MAKTDEYQICTAARNKLEEYVDPNEELKHPTWFKVPEWDVDSFEGLEYNSSEYKNEFSNDEDENQWRRFKRQLIENKGFY
VERELWPWYNYSDYKVVPNLDLPASFGQTYRGFDVEFVEVVRGIFSAGSRSKSFITFMAREKPDGPPVEYQAKVWCTVVR
NQNYPILCRRALTTKPPSQN*

DNA
ATGGCTAAAACTGATGAGTACCAAATTTGTACAGCTGCTAGAAACAAACTCGAAGAGTACGTTGACCCTAACGAGGAGCT
AAAACATCCGACGTGGTTTAAAGTCCCTGAATGGGATGTGGACAGCTTCGAAGGTCTCGAGTACAATTCCTCTGAATATA
AAAATGAATTCTCTAATGACGAAGATGAAAATCAATGGCGCCGCTTTAAGCGCCAGCTCATCGAGAATAAGGGGTTTTAT
GTGGAGCGAGAGCTTTGGCCATGGTACAACTACTCGGATTACAAAGTAGTCCCTAATTTGGATTTGCCTGCCAGTTTCGG
GCAAACCTACCGAGGTTTCGATGTGGAGTTTGTGGAAGTGGTGCGAGGTATATTTTCAGCAGGATCAAGGTCAAAGTCGT
TCATCACATTCATGGCTAGGGAGAAACCTGATGGACCTCCTGTTGAGTATCAAGCTAAGGTTTGGTGTACGGTTGTTCGA
AACCAGAACTATCCCATCCTCTGTAGACGGGCTCTCACAACAAAGCCTCCAAGCCAAAACTAG