Details for Arabidopsis Locus AT3G05675

Position : Chr3 ( 5`- 1658216 .. 1660368 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05675

Protein [Map View]
MEPRDNQAEASYTFGDRSSSDIVVRLRNEEGRDDWIYCHSKILSEKSQYFADRLSDKWPTCKILDSRYCVEVICQESDYD
HHINLLRLLYVVSDDVHEDNLCHNVKSALGILSVAKELSCPQIVTACVNYLEAVPWEEGEEEEILRIVPRIGSEAEPILA
RLQPVDQSAVLEIFVSAFRFATSSPPLLLGDIKSSAQEQIEYMITEDDDAPLLIADEEVKLEVKQCVKSLFVRFFQCLEE
ITLKPVESEVINKKGSFRMVLSDMCWVFQILTKMEVVRDFVITWADISEKLVKVVEQLETTVVEAVEIRVKVIEVTAKVI
EAIGYGTVILPTAKRLQMVKLWLPFVRNTKPLVDSPVREDEENDTVRYKIDGEIWQALESSFVSIILALPSADQAEILTE
WLSKNGLYPDLTEAFEVWCYRSKVAKRRLGLVGGEEENGMS*

DNA
ATGGAGCCTCGAGATAATCAAGCCGAGGCTTCATATACATTTGGTGATCGATCAAGCAGTGACATAGTTGTTAGACTAAG
AAATGAAGAAGGTCGTGATGATTGGATCTATTGCCATTCCAAGATCCTTAGTGAGAAAAGCCAGTATTTTGCTGACCGTC
TCTCTGATAAATGGCCCACTTGCAAGATTCTTGATTCACGTTACTGTGTTGAGGTCATCTGTCAAGAATCAGACTATGAT
CATCATATCAATCTCTTAAGACTTCTCTATGTTGTCTCTGATGATGTCCATGAGGATAACTTGTGTCATAATGTGAAAAG
TGCGTTGGGGATTCTCTCTGTCGCTAAAGAACTTAGTTGCCCTCAGATTGTCACTGCTTGTGTCAACTACTTGGAAGCTG
TTCCATGGGAAGAAGGCGAAGAGGAAGAGATTCTGCGGATTGTACCGAGGATTGGATCAGAAGCAGAGCCGATTCTTGCC
CGTCTCCAACCAGTTGATCAGTCCGCTGTTCTTGAAATCTTTGTATCGGCTTTTAGGTTTGCTACTTCGTCCCCGCCTTT
GCTCTTGGGTGACATAAAATCCTCTGCTCAAGAACAGATTGAGTATATGATAACTGAAGATGACGATGCACCGTTGTTGA
TTGCTGATGAAGAAGTCAAGCTTGAAGTAAAACAATGTGTAAAGAGCCTGTTTGTTAGATTCTTCCAGTGCCTAGAAGAA
ATCACTTTGAAACCCGTCGAGTCTGAGGTAATCAACAAAAAGGGGTCTTTTAGGATGGTCCTTTCAGATATGTGTTGGGT
TTTTCAGATATTAACGAAGATGGAAGTTGTTAGAGATTTTGTTATAACATGGGCTGACATATCTGAGAAGTTAGTTAAGG
TAGTTGAGCAGTTGGAAACAACAGTTGTAGAGGCTGTTGAGATAAGAGTCAAGGTCATCGAGGTGACTGCAAAAGTCATA
GAAGCGATTGGTTATGGAACAGTGATATTACCAACAGCGAAACGGCTTCAGATGGTAAAACTATGGCTTCCTTTTGTAAG
AAACACAAAGCCTCTTGTTGACTCACCGGTTAGAGAAGATGAGGAGAATGATACTGTGAGATATAAAATCGACGGAGAGA
TATGGCAAGCTTTAGAATCTTCCTTTGTATCGATAATTCTGGCATTGCCATCTGCAGACCAAGCTGAGATATTGACTGAA
TGGTTAAGCAAGAATGGGTTGTATCCGGATTTAACAGAAGCTTTCGAGGTTTGGTGTTACAGATCGAAAGTCGCGAAGAG
AAGATTGGGTTTAGTCGGGGGTGAAGAGGAGAACGGCATGTCTTAA