Details for Arabidopsis Locus AT3G05670

Position : Chr3 ( 5`- 1653264 .. 1657159 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05670

Protein [Map View]
MGKRNTSWARNSNRKVRSKDKGSDESDEDYVISDEDEEESEADLKEEYASSVDGEPSFDGFNGSDAVEDEELDEVEEEDV
MLRNVEWPKVKTGPRGNRKITGCKSRKTNQVVVSDNEDVDLDDADDEDDEIRNSRNAVGKSGSLDGEKHQRIGLGKRRRV
FYEIEDEDGDYPEEDGDEEEERDVENVDSNSLHDGEDGKMALEEQDNVSHETEKEDDGDYEDEDEDDDGDEDFTADEDVS
LDEEEEEEIIACNKNALKVCKGNKRKRRSGEGRKRRKKCSVAKTRLTRGRKRRVRNTKKGVDEDDDDFVDDCLPARKKAK
TKSSRPRPRRRCTVPSDSDVASSGESDYEYTISEEEREQIREAGSLLKSSVNHASSIRQTTVNKDLPQLRKSPVKKGEKK
VELVKRDVIKNVCGICLSEEDMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTPGVDLREVVIPV
PERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDLCDSSAHTYCVGLGREVPEGNWYCEGCRPVALGSASSQ
THIISEQQRGSGFYSRPSPLVVSGQYQDVSLIVSPRTPFFNGENLFSPRIPNGDAQGSSPSGLGATTLSRRRTLHRHIQN
IINGDRLINMGARTGGTSSDGFVTTQIGHGRTIDPSQPVASQETGISLYAISEERLPNNNSLISAHDPELLSPKLDEFGS
EEAFRRLSNNTFLGERPIDLGFHHGLAQGDPLVSNQQRLHSHMPNTMSSMAGERLQERVKAHLKNLSSQNDLGQTTFDEI
STCSIHTILAACGLEHESSEVHLVPPPVTCTHHHMTPGSSSSSSSGSSLMKGCCYSCFDSFVEDVVKMILDTRQPHWLSL
GLH*

DNA
ATGGGAAAGAGAAACACGTCTTGGGCTAGAAATTCTAATAGAAAGGTTAGATCTAAGGATAAGGGTTCAGATGAGTCAGA
TGAGGATTATGTGATTTCCGACGAGGATGAAGAAGAGTCTGAGGCTGATCTCAAGGAGGAGTATGCCTCATCTGTTGACG
GTGAGCCATCCTTTGATGGTTTTAATGGGTCTGATGCGGTGGAGGATGAGGAATTAGATGAAGTGGAAGAGGAAGATGTG
ATGCTGAGGAATGTTGAATGGCCAAAAGTGAAGACTGGTCCTCGTGGTAATCGAAAAATCACGGGATGTAAGTCAAGAAA
GACGAACCAGGTGGTTGTGTCTGACAACGAGGATGTGGATCTCGATGATGCGGATGATGAAGATGATGAGATAAGGAATT
CAAGGAATGCTGTTGGGAAAAGTGGGTCTTTGGATGGAGAGAAACACCAAAGGATAGGTTTAGGAAAGCGAAGGAGAGTT
TTCTATGAGATAGAGGATGAAGATGGAGACTATCCAGAGGAGGATGGTGATGAAGAGGAAGAGAGGGATGTGGAAAATGT
GGATTCAAATTCTTTGCATGATGGTGAAGACGGGAAGATGGCATTGGAAGAGCAGGACAATGTGTCACACGAGACAGAAA
AGGAAGATGATGGAGATTATGAGGATGAGGATGAGGATGATGATGGCGATGAAGATTTTACCGCAGATGAAGATGTCTCA
TTAGATGAGGAAGAGGAGGAAGAAATCATTGCATGTAACAAAAATGCACTGAAGGTTTGTAAGGGAAACAAGCGAAAGCG
AAGATCTGGAGAAGGGCGTAAAAGAAGGAAGAAATGCTCTGTTGCAAAAACCCGTTTAACAAGGGGAAGAAAGAGACGTG
TGAGAAACACAAAGAAAGGAGTTGATGAAGATGATGATGATTTTGTAGATGACTGCTTACCTGCAAGAAAGAAGGCGAAG
ACAAAGTCATCAAGGCCAAGGCCAAGGCGTCGGTGTACCGTTCCATCAGATTCAGACGTTGCATCGTCTGGAGAATCCGA
CTATGAGTATACAATCTCGGAGGAGGAAAGAGAGCAGATAAGAGAAGCCGGTAGTTTGTTGAAAAGTAGTGTGAACCATG
CATCATCTATAAGACAAACCACGGTCAATAAGGATTTGCCACAGCTTCGTAAGTCTCCTGTGAAGAAAGGTGAAAAGAAG
GTAGAGCTAGTGAAAAGAGATGTGATAAAAAACGTTTGTGGGATTTGTCTGTCTGAGGAAGACATGCGGAGATTGAAGGG
AACATTGGACTGCTGTAGCCATTACTTTTGTTTCACTTGCATAATGGAGTGGTCGAAAGTAGAATCTCGCTGCCCACTCT
GCAAGCAGCGGTTCAGAACAATCAGTAAGCCTGCAAGATCTACACCTGGAGTAGATTTGAGAGAAGTTGTGATACCTGTA
CCTGAACGTGATCAGGTCTATCAACCTACTGAAGAAGAGTTGAGGAGTTATCTCGATCCCTATGAAAATATAATATGCAC
GGAATGTCACCAAGGTGATGATGATGGGCTTATGTTGCTTTGTGATCTTTGTGATTCATCTGCCCATACGTACTGTGTTG
GTCTTGGGAGGGAAGTACCTGAAGGAAACTGGTACTGTGAAGGTTGTAGACCCGTTGCACTTGGATCAGCTAGTTCCCAA
ACGCATATTATATCCGAGCAACAAAGGGGTAGTGGCTTTTACAGTAGACCGTCACCTCTTGTAGTTTCAGGGCAATATCA
AGATGTGTCTTTAATAGTCTCCCCACGTACACCATTTTTCAATGGAGAGAACCTATTTTCTCCAAGGATTCCTAATGGTG
ATGCTCAAGGTTCTTCTCCATCCGGCTTAGGGGCAACCACATTATCCAGAAGAAGGACGCTTCACAGACACATACAAAAT
ATTATCAACGGTGATAGACTTATTAATATGGGTGCTAGAACTGGTGGAACATCGAGTGATGGTTTCGTGACTACACAAAT
AGGTCATGGCAGAACAATCGACCCATCTCAGCCTGTAGCGAGCCAAGAAACAGGGATATCGTTGTATGCAATCTCTGAGG
AAAGACTACCCAACAACAATTCATTGATTTCTGCCCATGACCCTGAGCTTTTGTCTCCAAAGTTAGATGAATTTGGAAGT
GAAGAAGCATTCAGACGTTTGTCTAATAATACATTTCTTGGTGAGCGACCTATCGATTTAGGATTCCATCATGGACTGGC
TCAGGGTGATCCCTTGGTTAGTAATCAACAACGTCTACACAGCCACATGCCAAACACAATGTCTTCCATGGCAGGAGAAC
GACTGCAAGAAAGAGTTAAAGCCCATCTCAAAAACTTGTCCAGTCAAAACGACTTAGGTCAAACCACTTTCGACGAGATT
TCCACGTGCTCAATACACACGATACTGGCAGCTTGTGGGCTTGAACACGAGAGCAGTGAAGTCCATCTTGTTCCGCCACC
AGTGACGTGTACTCACCATCATATGACACCTGGCAGCAGCAGCAGTAGCAGTAGTGGTAGTAGCCTGATGAAAGGGTGTT
GCTATTCTTGTTTTGATTCATTTGTAGAAGATGTAGTTAAGATGATTCTAGACACAAGACAACCCCATTGGTTGAGTCTA
GGGCTCCACTAA