Details for Arabidopsis Locus AT3G05630

Position : Chr3 ( 5`- 1635200 .. 1640348 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05630

Protein [Map View]
MSTDKLLLPNGVKSDGVIRMTRADAAAAAASSSLGGGSQIFDELPKAAIVSVSRPDTTDFSPLLLSYTLELQYKQFKWTL
QKKASQVLYLHFALKKRLIIEELHDKQEQVREWLHSLGIFDMQGSVVQDDEEPDDGALPLHYTEDSIKNRNVPSRAALPI
IRPTIGRSETVVDRGRTAMQGYLSLFLGNLDIVNSKEVCKFLEVSRLSFAREYGSKMKEGYVTVKHLRDVPGSDGVRCCL
PTHCLGFFGTSWTKVWAVLKPGFLALLEDPFSGKLLDIMVFDTLGLQGTKESSEQPRLAEQVKEHNPLRFGFKVTSGDRT
VRLRTTSSRKVKEWVKAVDEAGCYSPHRFGSFAPPRGLTSDGSQAQWFVDGHTAFEAIAFAIQNATSEIFMTGWWLCPEL
YLKRPFEDHPSLRLDALLETKAKQGVKIYILLYKEVQIALKINSLYSKKRLQNIHKNVKVLRYPDHLSSGIYLWSHHEKI
VIVDYQVCFIGGLDLCFGRYDTAEHKIGDCPPYIWPGKDYYNPRESEPNSWEETMKDELDRRKYPRMPWHDVHCALWGPP
CRDVARHFVQRWNHSKRNKAPNEQTIPLLMPHHHMVLPHYLGTREIDIIAAAKPEEDPDKPVVLARHDSFSSASPPQEIP
LLLPQETDADFAGRGDLKLDSGARQDPGETSEESDLDEAVNDWWWQIGKQSDCRCQIIRSVSQWSAGTSQPEDSIHRAYC
SLIQNAEHFIYIENQFFISGLEKEDTILNRVLEALYRRILKAHEENKCFRVVIVIPLLPGFQGGIDDFGAATVRALMHWQ
YRTISREGTSILDNLNALLGPKTQDYISFYGLRSYGRLFEDGPIATSQIYVHSKLMIVDDRIAVIGSSNINDRSLLGSRD
SEIGVVIEDKEFVESSMNGMKWMAGKFSYSLRCSLWSEHLGLHAGEIQKIEDPIKDATYKDLWMATAKKNTDIYNQVFSC
IPNEHIRSRAALRHNMALCKDKLGHTTIDLGIAPERLESCGSDSWEILKETRGNLVCFPLQFMCDQEDLRPGFNESEFYT
APQVFH*

DNA
ATGTCGACGGATAAATTACTACTTCCTAACGGCGTTAAGTCAGACGGAGTCATCAGAATGACCAGAGCTGATGCTGCGGC
GGCGGCAGCTTCTTCTTCTCTCGGCGGTGGAAGTCAAATATTCGACGAGCTTCCCAAGGCTGCGATCGTCTCGGTCTCGA
GACCTGACACCACCGATTTTAGTCCCTTGCTTCTTTCTTACACCTTGGAGCTTCAGTATAAACAGTTCAAGTGGACATTA
CAAAAGAAGGCTTCTCAAGTTCTGTACTTACATTTTGCGTTGAAGAAACGTTTGATCATTGAAGAACTTCACGACAAGCA
AGAACAGGTTAGAGAGTGGCTACACAGCTTGGGGATTTTTGATATGCAAGGATCAGTTGTGCAAGATGATGAAGAACCTG
ACGATGGTGCTCTTCCTCTGCACTATACTGAAGATAGTATCAAGAACAGGAATGTTCCTTCCCGTGCAGCGCTTCCAATC
ATTCGTCCAACGATAGGCCGGTCAGAGACAGTTGTAGATCGTGGGAGAACCGCAATGCAAGGCTACTTGAGTCTCTTTCT
AGGGAACTTGGACATTGTAAACTCCAAAGAGGTCTGCAAGTTCCTAGAAGTTTCTAGACTCTCATTTGCTAGAGAGTACG
GTTCCAAGATGAAAGAAGGGTATGTCACAGTGAAGCACTTGAGGGACGTCCCAGGTTCTGATGGTGTCCGATGCTGTCTT
CCTACACACTGTCTCGGTTTCTTCGGAACTAGCTGGACAAAGGTTTGGGCGGTTCTGAAACCAGGATTTTTGGCGTTACT
AGAAGATCCATTCAGCGGAAAGCTTCTAGATATAATGGTGTTCGACACATTGGGGTTGCAAGGTACTAAAGAGTCTTCTG
AACAACCGCGTTTGGCTGAACAGGTGAAGGAACACAACCCATTGCGTTTTGGCTTTAAAGTTACTAGTGGGGACCGAACC
GTGAGGCTGAGAACAACGAGCAGCAGGAAAGTTAAAGAGTGGGTTAAGGCCGTGGACGAAGCTGGTTGTTACAGTCCACA
TCGGTTTGGTTCGTTTGCACCACCTAGAGGCTTGACATCGGACGGAAGCCAGGCACAGTGGTTCGTAGACGGTCACACTG
CGTTTGAAGCTATCGCGTTTGCAATCCAAAACGCAACATCAGAGATATTTATGACTGGTTGGTGGTTATGTCCGGAGCTA
TATCTCAAACGCCCCTTTGAAGATCATCCATCATTGCGGCTCGATGCATTGCTGGAGACAAAAGCAAAACAGGGCGTTAA
GATATATATTCTTCTGTATAAGGAAGTCCAAATCGCGCTGAAAATCAACAGCTTGTACAGCAAGAAACGGCTTCAAAACA
TTCACAAGAACGTCAAAGTTCTTCGTTATCCAGACCATCTCTCCTCCGGCATTTACCTCTGGTCGCACCACGAGAAAATA
GTGATTGTAGATTACCAAGTTTGTTTCATTGGAGGGTTAGATCTCTGTTTTGGGCGGTACGATACAGCGGAGCACAAGAT
TGGAGATTGCCCTCCTTATATATGGCCTGGAAAAGATTACTACAATCCTAGAGAATCTGAACCAAATTCGTGGGAAGAAA
CGATGAAAGATGAGTTAGACAGGAGAAAGTACCCGCGAATGCCGTGGCACGATGTCCACTGCGCTCTATGGGGACCGCCT
TGTCGGGATGTGGCTCGACATTTTGTCCAGCGGTGGAACCACTCTAAGAGAAACAAGGCACCTAATGAACAGACGATTCC
ATTGTTGATGCCTCACCACCACATGGTTCTTCCTCACTACTTGGGAACTAGAGAGATCGATATAATCGCAGCGGCTAAAC
CAGAGGAAGACCCTGACAAACCTGTCGTTCTTGCCAGACATGACTCTTTCTCTTCTGCCTCACCGCCCCAAGAAATCCCT
TTGCTTCTCCCACAAGAAACCGATGCAGATTTCGCCGGCAGAGGAGATCTGAAGTTAGACAGCGGTGCAAGACAAGATCC
TGGGGAAACTTCAGAGGAAAGCGATCTGGACGAGGCTGTGAACGACTGGTGGTGGCAGATTGGGAAGCAGAGTGATTGCC
GGTGTCAAATAATCAGAAGTGTTAGCCAATGGTCTGCTGGGACGAGCCAGCCTGAAGATAGCATTCATAGAGCTTATTGT
TCGCTTATCCAGAACGCTGAACATTTTATCTACATAGAGAACCAATTCTTCATCTCCGGGCTAGAAAAAGAGGACACGAT
CCTAAACCGCGTTCTAGAAGCGTTATACAGACGCATTCTGAAGGCTCATGAAGAGAACAAGTGCTTCCGCGTTGTGATCG
TTATTCCGCTACTCCCTGGATTTCAGGGAGGTATTGATGACTTCGGAGCAGCCACGGTTCGAGCACTGATGCATTGGCAA
TACCGTACGATCTCTAGAGAAGGAACTTCGATTCTTGACAACCTTAACGCTTTGCTCGGTCCCAAGACGCAAGATTACAT
CTCTTTCTATGGTTTGAGATCGTACGGACGGCTGTTTGAGGACGGTCCAATTGCCACTAGCCAGATTTACGTGCATAGCA
AGTTAATGATTGTTGATGACCGGATCGCAGTGATCGGATCTTCTAATATAAACGATAGGAGCTTACTAGGTTCACGAGAC
TCTGAGATCGGTGTTGTGATTGAAGACAAAGAATTCGTGGAATCTTCGATGAACGGAATGAAGTGGATGGCCGGGAAGTT
CTCTTACAGTCTTAGATGTTCCTTGTGGTCAGAGCATCTCGGCCTTCACGCCGGAGAGATTCAGAAGATCGAAGATCCAA
TCAAAGATGCAACATACAAAGACTTATGGATGGCAACAGCTAAGAAAAACACGGACATCTACAACCAAGTCTTCTCGTGC
ATCCCGAATGAACATATACGCTCAAGAGCTGCATTGAGACACAATATGGCTCTTTGTAAAGACAAGTTGGGTCACACTAC
GATCGACCTTGGCATTGCACCGGAGAGGCTAGAATCATGCGGCAGCGACTCGTGGGAGATTCTGAAGGAGACAAGAGGGA
ACCTTGTGTGCTTCCCATTACAGTTCATGTGTGATCAAGAAGATCTCAGACCAGGTTTCAACGAATCTGAGTTCTACACT
GCTCCTCAAGTCTTCCACTAA