Details for Arabidopsis Locus AT3G05625

Position : Chr3 ( 5`- 1632284 .. 1634139 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05625

Protein [Map View]
MSLTQIVNPIIYPSRTIPRRFTAISPFKTLSPQFSRHPPHALSRRLFLPSVSSIWDAITGGGDSNPREAIAAVRRGMQLF
RQGDVAGSVAEFDRAIILDPRQKAYLWQRGLSLYYVDRFEEGAEQFRIDVAQNPNDTEESIWCFICEARLHGVDVARTQF
LEVGRDSRPVMREAYNLFKNGGDPEKLVNDFSSGQASEYFYASLYAGLYYEAEGKSENAKFHLTAACGSPYGQRSDDYMA
SLAKVHCLCRNWSSGIL*

DNA
ATGTCACTAACCCAGATCGTGAATCCAATCATATATCCATCTCGCACAATTCCACGGCGTTTCACGGCGATCTCGCCTTT
TAAAACCCTAAGTCCCCAATTTTCCCGCCACCCACCTCACGCACTGTCTCGTAGACTCTTCCTTCCTTCTGTTTCCTCTA
TATGGGATGCCATAACCGGCGGCGGAGATTCGAACCCTCGTGAGGCCATCGCAGCGGTTCGACGCGGAATGCAGCTCTTC
AGACAGGGTGATGTTGCTGGATCGGTGGCAGAGTTCGATAGAGCAATCATTTTGGATCCCAGGCAAAAGGCATATCTTTG
GCAACGCGGGCTTTCTCTTTACTATGTAGATAGGTTTGAAGAAGGTGCAGAGCAGTTCCGGATAGATGTTGCTCAGAATC
CTAATGACACAGAGGAGTCCATTTGGTGCTTTATCTGCGAGGCGAGGCTCCATGGTGTTGATGTTGCACGAACACAGTTT
CTCGAGGTTGGTAGAGATTCTCGGCCTGTGATGCGAGAAGCTTATAATCTATTCAAGAATGGTGGTGATCCTGAAAAGTT
AGTAAATGACTTCTCTAGCGGTCAAGCAAGCGAATACTTCTATGCTTCTCTGTACGCAGGGCTCTACTATGAAGCTGAGG
GTAAATCAGAAAACGCAAAGTTTCATTTAACCGCGGCTTGTGGATCTCCATATGGGCAGAGGTCTGATGATTATATGGCT
TCACTTGCTAAAGTCCATTGCCTTTGTAGAAACTGGAGCTCCGGTATTCTTTGA