Details for Arabidopsis Locus AT3G05600

Position : Chr3 ( 5`- 1623244 .. 1624763 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05600

Protein [Map View]
MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQISGLSSLGYRAVAPDLRGYGDSDSPESFSEYTCLN
VVGDLVALLDSVAGNQEKVFLVGHDWGAIIGWFLCLFRPEKINGFVCLSVPYRSRNPKVKPVQGFKAVFGDDYYICRFQE
PGKIEGEIASADPRIFLRNLFTGRTLGPPILPKDNPFGEKPNPNSENIELPEWFSKKDLDFYVSKFEKAGFTGGLNYYRA
MDLNWELTAPWTGAKIQVPVKFMTGDFDMVYTTPGMKEYIHGGGFAADVPTLQEIVVIEDAGHFVNQEKPQEVTAHINDF
FTKLRDNNKSF*

DNA
ATGGAAGGAATCGATCATAGAATGGTGAGTGTCAATGGCATAACAATGCACATTGCCGAGAAAGGTCCCAAAGAAGGACC
TGTGGTGCTTCTCCTCCATGGATTCCCTGATCTCTGGTACACGTGGCGTCACCAGATTAGTGGGTTATCATCTCTAGGTT
ACCGCGCTGTAGCTCCAGACCTCCGAGGCTACGGAGACTCTGATTCGCCGGAGTCTTTCTCCGAGTACACGTGTCTTAAC
GTCGTTGGGGACCTCGTAGCTCTTCTGGACAGTGTTGCTGGAAATCAAGAGAAGGTGTTTCTGGTCGGTCATGATTGGGG
AGCCATTATCGGATGGTTTCTCTGTTTGTTTCGACCTGAAAAGATTAACGGCTTTGTGTGTTTGAGTGTGCCGTATAGAT
CAAGAAACCCTAAAGTCAAGCCCGTTCAAGGGTTCAAGGCTGTATTTGGAGATGATTACTACATTTGTAGATTTCAGGAA
CCGGGGAAGATTGAAGGAGAGATTGCAAGTGCAGATCCAAGAATATTTCTGAGGAACCTCTTCACAGGGAGGACACTCGG
TCCGCCGATTTTACCTAAGGATAATCCCTTTGGGGAAAAACCTAACCCTAATAGCGAAAACATTGAATTGCCTGAATGGT
TTTCTAAGAAAGATCTCGATTTCTATGTCTCCAAATTCGAGAAGGCAGGATTTACCGGTGGATTGAACTACTACAGAGCC
ATGGATCTGAATTGGGAGCTCACTGCACCATGGACCGGAGCTAAGATTCAAGTTCCAGTGAAGTTCATGACAGGTGACTT
CGACATGGTGTACACCACACCAGGGATGAAAGAGTACATTCACGGTGGTGGATTTGCTGCAGATGTTCCAACTCTTCAAG
AGATAGTGGTGATTGAAGATGCTGGTCACTTCGTTAACCAAGAGAAACCTCAAGAGGTCACTGCTCACATCAATGACTTC
TTCACCAAGCTTCGGGACAACAACAAAAGCTTTTAG