Details for Arabidopsis Locus AT3G05570

Position : Chr3 ( 5`- 1616102 .. 1617339 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05570

Protein [Map View]
METQKTQAENPPKPATSSCRKKTKDDANFLEDVKDHIDDFINASMDDHKNCFNKTIKKMFGLSKAVADKQQSEAKGGVES
YLPLQTTVSD*

DNA
ATGGAGACGCAGAAAACTCAAGCTGAAAACCCGCCAAAACCGGCCACGTCTTCATGTCGAAAGAAGACAAAGGATGATGC
CAATTTCCTAGAAGACGTCAAGGATCACATCGATGATTTCATTAATGCTTCCATGGATGATCACAAGAACTGTTTCAACA
AAACCATCAAGAAGATGTTTGGGTTGTCAAAGGCTGTTGCGGATAAGCAGCAAAGTGAGGCTAAAGGAGGAGTCGAGAGT
TATTTGCCTCTTCAGACAACAGTCTCAGATTAG