Details for Arabidopsis Locus AT3G05550

Position : Chr3 ( 5`- 1612860 .. 1613748 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05550

Protein [Map View]
MVESKTKFEEIRKWVSDHKLRTVGCLWLSGITGSIAYNWSQPAMKTSVKIIHARLHAQALTLAALAGAAVVEYYDHKTEA
TNRYPKFLPPENLSHKD*

DNA
ATGGTGGAATCAAAGACCAAATTTGAAGAAATCAGAAAATGGGTCTCCGATCACAAACTTCGTACCGTCGGTTGTTTATG
GCTAAGTGGTATTACCGGTTCTATCGCCTATAACTGGTCCCAACCTGCCATGAAAACCAGTGTCAAGATCATCCACGCCA
GGTTGCACGCTCAGGCGCTGACTTTAGCTGCTTTGGCTGGAGCAGCCGTGGTGGAGTACTATGACCACAAAACTGAAGCT
ACCAACCGCTATCCGAAGTTTCTGCCACCGGAAAATTTATCTCACAAAGACTAA