Details for Arabidopsis Locus AT3G05545

Position : Chr3 ( 5`- 1609211 .. 1612523 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05545

Protein [Map View]
MGLGNKGNKFNFGDNDLADEASGADGDEGDGFGSVACSICLETVVKNGDRAWANLQCDHQFHLDCIGSAFNAKGVMQCPN
CRKVEKGQWLYANGCRSYPEFNVEDWVHEEDIYDIGAYSEMSFGVHWCPFGSSARLPSFEDGEFSPSSYHDLLGQQGYYT
EPAAPTAGHPCPYVTYFGPVHSPSSSSGGAAGVSDSSSFSSHWNTGSSVSGEVPTPYGFPVDPHYHGWDYHPPPPPPPQH
FSASGAHVGSPTQPTPPPAAARTSRANGSDMIRPRPPHFTRPFHGHSSSGRAGSSVASVPRTPPFPGSNARTRDRMQALQ
AYYQQSSAQSHQPDSPIVSRGPVFPSGRRPARGIASGMGSTSSSSDQAGGSGFIRFNIWERDPYMQSQQAYSVNQMDREP
NIWTSSFNEGSGSFHQRHGGGGGSS*

DNA
ATGGGTTTAGGCAATAAGGGTAACAAATTCAATTTCGGCGATAATGATCTCGCCGACGAAGCTAGTGGTGCCGATGGCGA
CGAAGGTGATGGTTTTGGTTCGGTTGCGTGTTCGATTTGTCTCGAGACGGTTGTTAAAAACGGCGATCGAGCATGGGCTA
ATCTTCAATGTGACCATCAGTTCCATCTAGATTGTATTGGTTCGGCTTTCAATGCAAAGGGAGTGATGCAATGCCCCAAC
TGTCGGAAAGTAGAAAAAGGCCAGTGGCTTTATGCAAACGGTTGTCGTTCATATCCCGAATTCAATGTCGAGGATTGGGT
TCACGAAGAAGATATTTATGATATTGGAGCATACTCTGAAATGTCTTTTGGAGTTCACTGGTGCCCATTTGGAAGCTCAG
CCCGTCTTCCTTCTTTCGAGGATGGAGAATTTTCACCGAGTTCATATCACGATCTTTTGGGACAGCAAGGTTACTATACT
GAACCAGCAGCGCCAACCGCAGGTCATCCATGTCCATATGTAACCTATTTTGGCCCGGTTCACTCGCCTTCCTCAAGCAG
TGGTGGTGCTGCAGGCGTTTCAGACAGTTCAAGTTTCAGTAGTCACTGGAACACTGGCTCTTCGGTTTCTGGTGAAGTCC
CAACTCCTTATGGTTTCCCTGTGGATCCGCACTATCACGGCTGGGATTATCATCCGCCTCCACCCCCACCGCCACAGCAT
TTCTCTGCTTCTGGCGCTCATGTGGGCAGTCCAACTCAGCCCACGCCTCCACCAGCCGCTGCGAGGACTTCTCGAGCCAA
CGGCTCAGATATGATCAGACCCAGACCGCCACATTTCACGCGTCCATTTCATGGTCACAGTTCCAGTGGTAGAGCGGGTA
GCTCGGTGGCATCTGTTCCGAGGACACCACCATTTCCAGGAAGCAACGCTCGGACCCGAGACAGAATGCAGGCTCTTCAA
GCCTATTACCAACAGTCTTCTGCACAGTCACACCAGCCGGATTCGCCTATAGTCTCTCGAGGGCCTGTATTCCCATCTGG
CCGGAGGCCCGCTAGAGGAATAGCTTCAGGGATGGGATCAACGTCATCTTCTTCAGATCAGGCAGGTGGGAGTGGTTTTA
TCCGGTTTAACATATGGGAGAGAGATCCTTATATGCAATCACAACAAGCCTACTCGGTTAATCAGATGGACAGAGAACCA
AACATTTGGACATCTTCATTTAATGAAGGATCAGGAAGCTTCCATCAGAGGCACGGTGGCGGAGGAGGATCATCTTAA