Details for Arabidopsis Locus AT3G05540

Position : Chr3 ( 5`- 1606487 .. 1608030 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05540

Protein [Map View]
MLVYQDILTGDELLSDSFPYKEIENGMLWEVEGKWVVKGAMDFDIGANPGEEGGEDEGVDDQAVKVVDIIDTFRLQEQPS
FDKKQFVMFMKRYIKQLSPKLDSENQELFKKHIESATKFLMSKLKDFQFFVGESMEGEEGSLVFAYYREGATDPTFLYLA
YGLKEIKC*

DNA
ATGTTGGTCTACCAGGATATTCTTACAGGCGATGAGCTTCTCTCTGATTCCTTTCCTTACAAGGAAATCGAGAATGGCAT
GTTATGGGAAGTTGAAGGAAAGTGGGTTGTGAAAGGAGCTATGGATTTTGACATAGGTGCGAATCCGGGTGAGGAAGGGG
GTGAAGACGAAGGAGTCGATGATCAAGCTGTGAAGGTTGTCGATATCATCGATACGTTTAGGCTTCAGGAGCAACCATCG
TTTGACAAGAAACAATTTGTGATGTTTATGAAAAGATACATCAAGCAACTAAGCCCTAAGTTGGACTCAGAAAACCAAGA
GCTGTTCAAGAAACACATTGAGAGTGCCACCAAATTCTTGATGTCAAAGCTCAAAGACTTCCAATTCTTCGTGGGAGAGA
GCATGGAAGGAGAAGAAGGGAGCTTAGTGTTTGCTTACTACAGAGAAGGAGCCACTGATCCTACTTTTCTCTACTTGGCC
TACGGCTTGAAAGAGATCAAGTGCTGA