Details for Arabidopsis Locus AT3G05530

Position : Chr3 ( 5`- 1603400 .. 1606231 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05530

Protein [Map View]
MATPMVEDTSSFEEDQLASMSTEDITRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVEI
LEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAM
EVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQ
LVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRA
DILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEV
NHEDFNEGIIQVQAKKKASLNYYA*

DNA
ATGGCAACTCCTATGGTTGAAGATACGTCAAGCTTCGAAGAGGATCAGCTTGCTTCCATGTCCACCGAAGATATCACTAG
AGCTACTCGTCTTCTCGACAACGAGATTCGAATTCTCAAGGAAGACGCGCAAAGAACAAATCTAGAATGTGATTCTTACA
AGGAGAAGATTAAGGAGAATCAGGAGAAGATTAAACTCAACAAGCAGCTGCCTTACTTGGTTGGCAACATTGTCGAGATT
TTGGAGATGAATCCAGAAGATGATGCTGAGGAAGATGGTGCAAATATTGATCTTGACTCGCAACGGAAAGGAAAATGTGT
TGTGTTGAAAACGTCTACACGGCAGACCATCTTTCTACCAGTTGTTGGACTCGTGGATCCTGATAGTTTGAAACCTGGTG
ACTTGGTTGGAGTTAACAAAGATAGCTACTTGATTTTGGATACCTTGCCATCCGAGTATGACTCTAGGGTTAAAGCCATG
GAGGTCGATGAAAAACCAACTGAAGATTACAATGACATTGGAGGACTAGAGAAGCAGATCCAAGAGCTTGTAGAGGCAAT
TGTGCTTCCCATGACGCACAAGGAACGTTTTGAGAAGCTGGGTGTTCGTCCACCAAAGGGAGTGCTCTTGTATGGTCCCC
CAGGGACTGGTAAAACTTTAATGGCTCGTGCCTGCGCAGCACAGACCAATGCCACCTTCCTTAAATTGGCAGGCCCTCAA
TTGGTCCAGATGTTCATTGGAGACGGAGCAAAGCTTGTCCGTGATGCCTTTCAACTTGCCAAAGAGAAAGCTCCGTGCAT
TATCTTCATAGATGAAATCGATGCCATTGGTACAAAGCGTTTCGACAGTGAAGTCAGCGGAGACAGGGAAGTGCAGAGGA
CTATGTTGGAGTTGCTCAATCAACTTGACGGATTCAGTAGCGATGAACGTATTAAGGTGATTGCAGCTACTAACCGTGCA
GATATTCTGGACCCAGCACTCATGCGTTCTGGTCGATTAGACAGAAAGATTGAGTTCCCACACCCAACCGAAGAAGCGAG
AGCAAGAATCTTGCAGATTCACTCAAGGAAGATGAATGTCCACCCAGACGTCAACTTTGAGGAGCTTGCACGATCAACAG
ATGATTTCAATGGAGCTCAGCTGAAAGCAGTGTGTGTAGAGGCAGGCATGTTAGCTCTTCGCCGTGATGCCACAGAGGTG
AACCATGAAGACTTCAATGAAGGTATCATCCAAGTCCAGGCCAAGAAGAAAGCAAGCTTGAACTACTACGCCTGA