Details for Arabidopsis Locus AT3G05500

Position : Chr3 ( 5`- 1593434 .. 1595015 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05500

Protein [Map View]
MATQTDLAQPKLDMTKEEKERLKYLQFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESVEGAVKTVVGPVYEKYHDVPV
EVLKYMDQKVDMSVTELDRRVPPVVKQVSAQAISAAQIAPIVARALASEVRRAGVVETASGMAKSVYSKYEPAAKELYAN
YEPKAEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAEEKAETEPL
EFHPLD*

DNA
ATGGCTACTCAAACGGATCTCGCTCAGCCCAAGCTTGATATGACCAAGGAGGAGAAAGAGAGGTTGAAGTATTTGCAATT
CGTGCAAGCTGCTGCTGTGGAAGCTCTGCTTCGCTTTGCTCTTATTTACGCTAAGGCAAAGGACAAGTCTGGTCCTTTGA
AACCTGGTGTTGAATCTGTTGAAGGAGCTGTCAAGACTGTCGTTGGTCCTGTCTACGAGAAATACCACGACGTCCCTGTT
GAGGTCCTTAAATACATGGACCAGAAGGTTGATATGTCTGTGACTGAGCTTGACCGTCGTGTCCCACCAGTCGTCAAGCA
AGTGTCTGCCCAAGCCATCTCCGCTGCTCAGATAGCACCCATTGTGGCACGTGCGTTGGCCTCTGAGGTTCGACGTGCTG
GTGTTGTTGAAACCGCTTCTGGAATGGCTAAATCCGTCTACTCCAAGTACGAGCCTGCTGCTAAGGAGTTGTATGCAAAC
TATGAGCCAAAAGCAGAGCAGTGTGCCGTTTCAGCTTGGAAGAAGCTTAACCAGCTTCCTCTATTCCCAAGGCTGGCTCA
AGTTGCTGTACCAACAGCTGCTTTCTGCTCTGAGAAGTACAATGATACTGTGGTTAAGGCTGCAGAGAAAGGGTACAGAG
TCACATCGTACATGCCATTGGTTCCAACAGAGAGGATCTCAAAAATCTTCGCTGAGGAGAAAGCTGAGACCGAGCCTTTG
GAGTTCCATCCACTTGATTGA