Details for Arabidopsis Locus AT3G05480

Position : Chr3 ( 5`- 1585302 .. 1588722 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05480

Protein [Map View]
MELSISGNALKTLSRSIICLARVGNELVVQASPTQLALHTLNASRSAYQCITFQSSFFDVYTVSGPQAHFSVLLKAVCSV
LRTPLASIDHMSVQLPDHDASKVKWTLQCYSAVLCKNLDVACFRPVHNSMKKTYWITCNVEPDIQHLSLDRGRFPSTLVM
HPRNLSKLLGNFQSSLQEITIIATDQTSFPSDAASEIGGKAVEFRSYVDPTKDGDSLLHTQLWIDPSEEFLQYTHAGDPV
DITFSLKELKAFLAFCEGCEADIHLFFEKAGEPILMAPKFGLGDGSSSSFDATLVLATMLVSQLQEGIPAEPPEAANSTG
GHAAEQVGSRPQERSRQNASEHPSDHTRVWSELSGTATKSVNGTEDRPQAQGQPDLDIHRIRNMEISKGGPVGDTAPAAP
PKSQRPTQIDHAEGSRVRVQNQSFSQHHPSNWVDANEEEEDDDEGVEATPPHNEDY*

DNA
ATGGAGTTGAGTATCAGTGGCAATGCGCTCAAGACCTTGTCTAGGTCTATAATCTGCCTCGCACGCGTCGGTAACGAGCT
CGTTGTCCAAGCTTCGCCGACACAGCTGGCATTGCACACTTTGAATGCTTCACGTTCTGCCTATCAGTGTATCACATTTC
AGTCAAGTTTCTTTGATGTATATACTGTTTCTGGTCCTCAAGCTCATTTCAGTGTACTTTTGAAGGCTGTTTGTTCTGTT
CTTAGAACCCCTCTCGCGAGCATTGATCATATGAGTGTGCAGTTGCCAGATCATGATGCATCTAAGGTCAAATGGACTTT
GCAGTGTTACAGTGCCGTCCTGTGTAAAAACCTGGATGTGGCATGTTTCAGACCTGTTCATAATAGTATGAAGAAAACAT
ATTGGATTACTTGCAATGTGGAACCAGATATACAGCATCTGTCCCTTGATAGGGGTAGATTTCCTAGTACCTTAGTCATG
CATCCTCGAAATCTGAGCAAGTTGCTTGGAAACTTCCAGTCATCCCTCCAAGAGATTACAATTATTGCTACAGACCAAAC
TTCTTTCCCCTCTGATGCTGCAAGTGAAATAGGTGGAAAAGCTGTTGAGTTTCGGAGCTATGTGGATCCTACCAAAGATG
GTGACTCTTTGTTACATACACAGCTATGGATTGATCCATCAGAAGAATTTTTGCAGTATACTCACGCAGGTGATCCAGTT
GACATCACATTTTCCTTGAAGGAACTAAAGGCATTTCTTGCATTCTGCGAGGGCTGTGAAGCCGATATTCATCTTTTTTT
CGAAAAAGCTGGCGAACCAATACTGATGGCTCCAAAATTCGGTTTGGGTGATGGGTCAAGCTCCAGTTTTGATGCAACAC
TCGTTCTTGCGACAATGCTTGTGTCTCAACTTCAGGAAGGGATTCCGGCAGAACCTCCTGAAGCAGCAAACTCCACAGGT
GGCCATGCTGCCGAGCAAGTAGGATCACGGCCTCAAGAACGGTCTAGGCAAAATGCCTCTGAGCACCCATCTGATCACAC
ACGAGTATGGTCTGAACTTTCAGGAACTGCCACTAAGAGCGTGAACGGTACTGAGGATAGGCCACAGGCTCAGGGACAAC
CAGACTTGGATATCCATAGAATTAGGAATATGGAAATATCAAAAGGCGGGCCAGTTGGAGATACTGCTCCTGCAGCTCCT
CCTAAGTCCCAACGTCCCACACAGATAGATCATGCTGAAGGATCCCGAGTACGGGTACAGAACCAAAGTTTCTCCCAGCA
CCATCCTAGTAATTGGGTGGATGCAAATGAGGAAGAAGAAGATGACGACGAAGGTGTCGAGGCGACACCACCTCACAATG
AAGATTATTAA