Details for Arabidopsis Locus AT3G05470

Position : Chr3 ( 5`- 1579667 .. 1582547 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05470

Protein [Map View]
MVYFRQIFLMIIVVSLHCCKVRFFCIVANAKELDDWKVLTVENGERYRTHVGRYAGEEGGEKIKLRVLEKFRALLDLIKP
STSRRRNLAESASFSPWPAPSPSPFPNGGPIESPAYPPAPPRPIPPHLRRPLPQRTHPLEQPEIQRRKHEKGGTFKKILV
PVVASTASAIGFVVCVVGVFCLCARRKRKMNGKTLSFKRKKGKSQSSTRKVSVNPTLDFLYLNSLGVDLERQNSVSVKEI
RETEKDLNGINGGLLEEEVKRSIETEISHDWDNASSYSTKEIVSVHENDEEQTVNSVSVPVVVINDSSDDDESFHSVGGG
SQYSNPRLSNASSASGSVNVGSSQRFSEHKLDIPECSRSDFGISVSAPPPPPPPPPPLPQFSNKRIHTLSSPETANLQTL
SSQLCEKLCASSSKTSFPINVPNSQPRPPPPPPPPQQLQVAGINKTPPPPLSLDFSERRPLGKDGAPLPKLKPLHWDKVR
ATPDRTMVWDKLRTSSFELDEEMIESLFGYTMQSSTKNEEGKSKTPSPGKHLLEPKRLQNFTILLKALNATADQICSALG
KGEGLCLQQLEALVKMVPTKEEELKLRSYKGAVDELGSAEKFLRALVGVPFAFQRAEAMLYRETFEDEVVHLRNSFSMLE
EACKELKSSRLFLKLLEAVLKTGNRMNVGTIRGGAKAFKLDALLKLSDVKGTDGKTTLLHFVVQEISRSEGIRVSDSIMG
RIMNQRSNKNRTPEEKEEDYRRMGLDLVSGLNTELRNVKKTATIDLEGLVTSVSNLRDGLGQLSCLASEKLKGDEENRAF
VSSMSSFLRYGEKSLEELREDEKRIMERVGEIAEYFHGDVRGDEKNPLRIFVIVRDFLGMLDHVCRELRCVRVPNSPSPL
APFR*

DNA
ATGGTTTATTTTCGTCAGATTTTTCTCATGATCATTGTAGTTTCATTACACTGCTGCAAAGTTAGATTCTTTTGCATTGT
TGCTAATGCTAAAGAGCTTGATGACTGGAAGGTGTTAACGGTGGAAAACGGTGAAAGATACCGAACCCATGTCGGAAGAT
ACGCCGGAGAAGAGGGCGGCGAGAAGATAAAGCTTCGAGTTTTGGAAAAGTTTCGAGCTTTACTCGATTTGATTAAACCC
TCTACTTCACGGAGAAGAAATCTCGCCGAGTCTGCTTCTTTCTCTCCTTGGCCGGCGCCGTCGCCGTCTCCGTTTCCCAA
CGGTGGTCCAATCGAATCTCCGGCGTATCCTCCAGCTCCTCCACGACCGATTCCTCCACATCTCCGTCGTCCGTTACCTC
AACGGACCCATCCATTGGAACAACCCGAGATTCAACGGCGAAAACATGAGAAAGGAGGAACATTTAAGAAGATTCTTGTA
CCTGTCGTTGCTTCCACAGCTTCTGCAATCGGTTTCGTAGTATGTGTCGTTGGAGTGTTCTGTCTCTGCGCGAGAAGAAA
AAGGAAAATGAACGGTAAAACGCTGTCGTTTAAAAGGAAAAAGGGAAAATCTCAAAGCTCGACGAGGAAGGTTAGTGTAA
ACCCTACTCTCGATTTCTTGTACCTAAACTCACTAGGAGTTGACTTGGAGAGACAAAACTCTGTTTCTGTTAAAGAAATA
CGAGAAACAGAGAAGGATTTGAACGGTATCAATGGTGGATTGCTTGAAGAAGAGGTAAAGAGAAGTATAGAAACAGAGAT
CTCACATGATTGGGACAATGCTAGTAGTTATTCGACCAAAGAGATTGTGTCGGTGCACGAAAATGATGAAGAACAAACAG
TAAACTCTGTTTCTGTTCCTGTTGTTGTAATCAATGATTCTTCAGACGATGATGAGTCTTTTCATTCCGTTGGTGGTGGC
TCTCAGTATTCAAATCCAAGATTGTCAAATGCTTCCTCTGCTTCTGGTAGTGTTAACGTTGGTTCCTCTCAACGCTTCTC
AGAACACAAATTGGATATTCCTGAATGTTCTAGAAGCGACTTCGGAATCTCTGTATCTGCTCCACCACCACCACCTCCAC
CGCCTCCACCGCTTCCGCAGTTCTCTAACAAACGTATTCACACCCTGTCTTCGCCAGAAACCGCTAATCTTCAGACGCTT
TCGTCGCAATTATGTGAAAAACTTTGTGCTTCTTCCTCGAAGACAAGCTTTCCGATCAATGTACCAAATTCTCAACCGCG
TCCACCGCCACCACCGCCCCCGCCACAACAGCTTCAAGTAGCTGGAATTAATAAAACGCCTCCACCGCCATTGTCTCTTG
ATTTTTCTGAGCGTAGACCATTAGGCAAAGACGGAGCTCCATTGCCTAAACTGAAGCCACTTCACTGGGATAAAGTCAGG
GCTACACCAGACCGGACTATGGTTTGGGATAAGCTCAGAACAAGCTCTTTTGAATTAGACGAAGAGATGATTGAGTCACT
GTTTGGATATACGATGCAAAGCTCAACGAAGAATGAGGAAGGGAAGAGCAAAACTCCATCACCAGGGAAACACCTTCTTG
AACCTAAAAGACTTCAGAATTTTACCATTCTCTTGAAAGCTCTCAACGCAACCGCGGACCAAATCTGCTCTGCCTTGGGG
AAAGGGGAAGGCTTGTGTTTACAGCAACTAGAAGCGTTGGTGAAGATGGTGCCGACTAAAGAAGAAGAGTTGAAGCTGCG
TAGCTACAAAGGAGCCGTGGATGAGCTTGGCTCAGCTGAGAAGTTTCTCAGAGCTCTTGTTGGAGTTCCATTTGCGTTTC
AGAGAGCTGAAGCAATGCTTTATAGAGAAACGTTTGAAGATGAAGTGGTTCATCTCAGAAACTCCTTCTCCATGCTTGAG
GAAGCTTGCAAGGAGCTTAAATCAAGCAGGTTATTCTTGAAGCTTCTAGAAGCTGTCCTAAAGACTGGAAACAGGATGAA
TGTAGGAACCATACGCGGTGGTGCAAAAGCATTCAAGCTCGATGCTCTGCTTAAACTCTCTGATGTTAAAGGCACAGATG
GAAAGACTACTCTGCTTCATTTTGTTGTACAAGAGATCTCTAGGTCTGAAGGAATCAGGGTTTCAGACAGCATCATGGGA
CGGATCATGAACCAGAGATCAAACAAGAACCGAACACCTGAGGAGAAAGAGGAGGATTACAGAAGGATGGGGCTCGATCT
CGTCTCGGGTCTAAACACAGAGCTACGAAACGTGAAGAAGACGGCAACGATTGATCTGGAAGGTCTTGTTACCTCGGTGT
CCAATCTGAGAGATGGGTTGGGGCAGTTGAGCTGTCTTGCGAGTGAGAAGCTGAAAGGGGACGAAGAAAACAGAGCATTT
GTTAGTTCGATGAGCTCGTTTTTGAGATACGGCGAGAAGAGCTTGGAGGAATTGAGGGAAGACGAGAAGAGGATAATGGA
GAGGGTTGGAGAGATTGCAGAGTATTTTCATGGAGATGTGAGAGGAGATGAGAAGAACCCATTGAGGATCTTTGTGATTG
TAAGGGATTTTCTAGGGATGTTGGATCATGTTTGTAGAGAATTGAGGTGTGTTAGGGTTCCCAATAGCCCTAGCCCTTTG
GCTCCGTTTCGATGA