Details for Arabidopsis Locus AT3G05460

Position : Chr3 ( 5`- 1577800 .. 1578734 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05460

Protein [Map View]
MKNVSFQLLFLVSLLVLVFGHDLVKGRTMDTNGGGVHTNRGSGFFHDNPPCNPRDPKCIDKPCNPENPNCRMEQGAIKPN
RGSGYLHDDPPCNPRDPKCIVKPCNPENPNCRMEQGAIKPNRGSGYLHDDPPCNPRDPKCIVKPCNPENPNC*

DNA
ATGAAGAACGTTTCCTTTCAGCTTTTGTTTTTGGTTTCTCTTCTTGTTCTTGTCTTTGGACATGATCTTGTGAAAGGTAG
GACAATGGATACAAATGGTGGCGGCGTGCATACAAATAGAGGCAGTGGATTTTTTCACGATAATCCTCCTTGCAATCCAA
GAGATCCAAAGTGCATAGATAAACCTTGTAATCCAGAGAATCCAAATTGCAGAATGGAACAAGGTGCCATTAAGCCAAAC
AGAGGCAGTGGATATCTTCACGATGATCCTCCTTGCAACCCAAGAGATCCAAAGTGCATAGTAAAACCTTGTAATCCAGA
GAATCCAAATTGCAGAATGGAACAAGGTGCCATTAAGCCAAACAGAGGCAGTGGATATCTTCACGATGATCCTCCTTGCA
ATCCAAGAGATCCAAAATGCATAGTAAAACCTTGTAATCCAGAGAATCCAAATTGCTAA