Details for Arabidopsis Locus AT3G05450

Position : Chr3 ( 5`- 1573909 .. 1576418 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05450

Protein [Map View]
MAPKSCDGEVNDGSSSDVNVMEPMETSTGVGLSFLGKRRAETPNPGESEQIADEDGEEYESVEDVVVEDDRIRGGRDEED
SEPEWGYDSFDGREYHSSDQMGYSDKEVSLSRQTVFLPSGVELVRSTILKRTLGKALPSGLNVKLEHILRANYNPGSMSK
FYITFAARESDSPDAPSEEYQAKAAWSAAEKTYPIFCRPSESKVYSIIEMAPKSSDGETKYGSSSDGEIKCGSSSENQST
ESMEITTGDESSMLGKRKVETTDLEDPDENDEEDPDENDEEDSESDSDSEWDKDSFDGREYHSSDDQREYATKDLEKRAR
FYKRTVIETKSSAEFPPYLWGGIATLRGLDEKMRTGVTGFNVKLDHVLRANFNPGGRTTYYITFAARESDSPDAPLVEYQ
AKVDWSAGKTYPILCRPTSPKLVEVDGGAQLKKVSEEIIN*

DNA
ATGGCTCCAAAATCATGCGACGGCGAGGTAAATGATGGATCTTCGAGCGACGTAAATGTGATGGAACCAATGGAAACATC
CACCGGCGTTGGCCTATCTTTTCTGGGGAAGCGCAGGGCCGAAACCCCCAACCCTGGTGAAAGCGAGCAAATAGCTGACG
AGGACGGAGAAGAATACGAATCAGTCGAGGACGTTGTTGTGGAAGACGATCGAATCAGAGGAGGAAGGGATGAGGAGGAT
AGTGAGCCGGAATGGGGTTATGATAGCTTCGATGGCCGAGAGTATCATTCCTCTGATCAGATGGGGTATTCGGACAAGGA
GGTTTCTTTGAGCCGTCAGACCGTTTTCCTCCCCTCTGGGGTGGAATTAGTTCGCTCTACGATCTTGAAGCGAACGCTGG
GAAAGGCCTTACCGTCCGGATTGAATGTGAAGTTGGAACATATCTTGAGGGCGAATTACAACCCTGGCTCCATGTCCAAG
TTTTACATTACATTTGCTGCAAGAGAGTCTGATTCTCCAGATGCACCTTCAGAGGAGTATCAAGCTAAGGCCGCATGGTC
TGCAGCCGAGAAGACTTATCCCATCTTTTGTAGACCAAGTGAATCTAAGGTTTACTCAATCATCGAGATGGCTCCTAAAT
CAAGCGACGGTGAGACCAAGTATGGATCTTCAAGCGACGGCGAGATCAAGTGTGGATCTTCAAGCGAAAACCAATCAACG
GAGTCAATGGAAATTACCACGGGAGATGAATCTTCTATGCTGGGGAAGCGCAAGGTTGAAACCACCGACCTGGAGGATCC
CGATGAAAATGACGAGGAGGATCCCGATGAAAACGACGAGGAGGATAGTGAAAGTGATAGTGATTCCGAATGGGATAAGG
ATAGCTTCGATGGCCGAGAGTATCATTCCTCTGATGATCAGAGAGAGTATGCCACCAAGGACCTTGAGAAGAGGGCCCGT
TTTTACAAGCGCACGGTCATCGAAACCAAGTCAAGTGCCGAATTCCCACCTTACCTATGGGGTGGAATTGCCACACTCCG
TGGTCTGGATGAAAAGATGCGTACAGGTGTGACAGGATTTAATGTGAAGTTGGATCATGTTTTGAGGGCTAATTTCAACC
CAGGGGGCAGGACAACGTACTACATCACTTTTGCTGCAAGAGAGTCTGATTCTCCTGATGCACCTCTAGTGGAGTATCAA
GCTAAGGTGGATTGGTCTGCAGGCAAGACTTATCCCATCCTTTGCAGACCCACTTCACCTAAATTGGTTGAAGTTGATGG
AGGAGCTCAATTGAAAAAGGTATCCGAGGAGATCATCAATTGA