Details for Arabidopsis Locus AT3G05430

Position : Chr3 ( 5`- 1567625 .. 1571072 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05430

Protein [Map View]
MNSAEVNVNPRVFGDSFVTFSGNGSGKFEMIDQAEAFLMELDSVAADTGSDGNGNVDLGSRVSNSETEPRFCEMKREIRD
SDHRFYELCNESGEKKMEKRRVPDYKSFLSEFDDYVAREKMGSRNSKALSYGFEVGDMVWGKVKSHPWWPGQIFNEAFAS
PSVRRVKKMGYVLVAFFGDNSYGWFDPAELIPFEPHVKEKSQQTSSDHFAKAVEEAMNEVGRRSALGLTCKCRNQYNFRP
INAQGYFAVDVPDYEVQAIYSSKQIQKARDSFSSVQTLAFVKRCALAPQECDTDSLKSFQKKVAVCAFRRAVFEEFDETY
EQAFRARSVYCLMKTHEPLNRAPLRVPLSGSLVSAETLGNPKSYTKAMNVKDSTKQDKYLPKRREEAGDMTVQFGQVQES
SQFQGINGSSAWDRLLQRRTPCLQTPRKHEQTGLVSMNFTSSSGNIPGKKSSVSKLSRDDDKGLAQESDVRMGEKATLFP
DQEKFEPMKSLKQDETGTNSRSNKSSLKLFSGGKFSAGVGIKKGNVVKRSSGEMKSENCPPEPKKKKKEYVSELNRDTPD
KRKALSSGEAWAKKSSQVDSAKRRSNMLIVKLDGLQLLSNLLALSLDPLFGSSDRSSFRVIRQFFFHFRSHVYQKSLATS
PSATKLSKSAKTLCRANEQSKAGRNRISSDSQQDVPSTKKLKKTIQFKPLASDKKTNQDATKRSSLAPLNPVRDQCRVPI
NAKPAIVQQEKKTGPSAMVVEPTMLVMMFPPGESLPSIDLLKARFGRFGQLDQSAIRVSWKSSICRVGFLYKLDAQTALR
YVSGSKSLFGNVNVTYFLRDMKASSASGDHELKKAKRPKTDKPITKPLNQLLEQAPPVHQPNIQLKSCLKKPGNNRNGNH
RTVRVKFMLGEKETESPFSVSILPLSSQDSEPKPVNNQVDHVEPPLDPSQLKVDISLQMMELLTRCNDAVANVTGLLGYV
PYHSL*

DNA
ATGAATTCGGCTGAGGTGAATGTGAATCCTAGGGTTTTTGGTGATAGTTTCGTTACTTTTTCTGGCAATGGCTCCGGGAA
ATTTGAAATGATTGATCAGGCCGAAGCTTTCCTTATGGAGCTTGATTCGGTTGCTGCAGACACTGGAAGTGATGGAAATG
GAAATGTCGATTTAGGTTCTCGAGTGTCTAACAGTGAAACGGAACCTAGATTTTGTGAAATGAAAAGAGAGATTAGAGAC
TCTGATCACCGATTTTATGAGCTCTGCAACGAATCTGGTGAGAAGAAAATGGAGAAAAGGCGAGTTCCGGACTACAAATC
TTTCTTATCCGAATTTGACGATTATGTTGCGAGGGAGAAAATGGGTTCTAGAAATTCGAAGGCATTGAGCTATGGTTTTG
AAGTGGGAGATATGGTTTGGGGAAAGGTAAAGTCACATCCATGGTGGCCAGGTCAAATATTCAATGAAGCTTTTGCGTCT
CCCTCTGTTCGTCGTGTGAAGAAGATGGGTTACGTTCTGGTTGCTTTCTTTGGGGATAATAGTTATGGATGGTTCGATCC
TGCTGAGCTTATCCCTTTTGAACCTCATGTGAAGGAGAAATCACAGCAAACTAGTTCGGATCACTTTGCAAAAGCTGTGG
AAGAAGCTATGAATGAAGTAGGTAGAAGGTCAGCTCTTGGCTTGACTTGTAAATGTCGGAATCAGTATAACTTTAGGCCT
ATTAATGCTCAAGGTTACTTTGCTGTAGACGTGCCTGATTACGAGGTCCAAGCTATTTACTCTTCTAAGCAGATTCAGAA
AGCTAGGGATAGTTTTTCATCTGTGCAAACTCTAGCTTTTGTGAAGCGGTGTGCATTAGCACCTCAAGAGTGTGATACAG
ACAGCTTAAAGTCTTTCCAGAAGAAAGTAGCGGTTTGTGCATTCCGTAGAGCAGTGTTTGAGGAGTTTGATGAAACATAT
GAACAAGCTTTCAGGGCAAGATCTGTATACTGTTTAATGAAGACACATGAACCACTTAATAGAGCACCCCTTCGAGTCCC
CTTGAGTGGCTCATTGGTCAGTGCAGAAACTCTGGGCAACCCAAAGAGCTACACAAAAGCTATGAATGTAAAGGATTCTA
CTAAACAAGACAAATATCTTCCAAAAAGAAGAGAAGAAGCTGGTGATATGACAGTTCAATTTGGCCAGGTCCAAGAATCT
TCTCAGTTTCAGGGCATCAACGGATCTTCAGCTTGGGATCGTCTACTCCAGAGAAGGACTCCATGTCTCCAAACTCCCAG
GAAACATGAGCAGACTGGGCTTGTCAGCATGAACTTCACCTCTTCAAGTGGTAATATTCCTGGAAAGAAATCCTCTGTTT
CAAAGCTCTCTCGTGATGATGACAAGGGTTTAGCTCAAGAGTCAGATGTGAGAATGGGAGAAAAAGCAACTCTATTTCCA
GATCAGGAGAAATTTGAACCAATGAAAAGCCTTAAACAAGATGAGACTGGAACAAATTCTAGATCTAACAAAAGCTCTCT
CAAGCTTTTTAGTGGTGGGAAATTTTCTGCAGGAGTTGGGATCAAGAAAGGCAATGTCGTGAAACGGTCTTCTGGCGAAA
TGAAATCTGAGAATTGTCCTCCAGAACCAAAGAAAAAGAAGAAAGAGTATGTGTCAGAGCTGAACCGTGACACTCCAGAT
AAGAGGAAAGCGTTATCTTCTGGAGAAGCTTGGGCCAAGAAATCGTCACAAGTAGATTCAGCAAAGAGACGCTCCAATAT
GTTGATAGTGAAACTTGATGGTCTGCAGCTGTTGAGTAATTTGCTAGCTCTCTCGCTTGACCCTCTCTTTGGATCCTCAG
ATAGAAGTTCTTTTAGAGTTATAAGGCAGTTCTTTTTTCATTTCCGATCACATGTTTACCAGAAAAGCTTGGCCACATCT
CCTTCCGCAACAAAACTGTCAAAATCTGCAAAGACTTTGTGCAGAGCTAATGAACAATCAAAGGCTGGGAGAAACCGCAT
ATCGTCTGACAGTCAACAAGATGTCCCATCAACTAAGAAGCTAAAGAAAACCATTCAGTTCAAACCACTGGCTTCTGACA
AGAAAACAAACCAAGATGCAACAAAGAGATCAAGTCTTGCACCTTTAAATCCAGTAAGAGACCAATGTCGAGTTCCCATC
AATGCCAAACCAGCTATAGTTCAACAAGAAAAGAAGACGGGTCCATCTGCAATGGTAGTTGAGCCAACAATGCTGGTCAT
GATGTTTCCTCCTGGTGAATCTCTCCCTTCCATTGATCTGCTTAAGGCGAGGTTTGGACGCTTTGGACAGTTGGATCAAT
CAGCCATCAGAGTTTCCTGGAAATCCTCGATCTGCCGTGTTGGCTTCCTGTATAAACTCGATGCGCAGACTGCCTTAAGA
TATGTATCAGGAAGCAAATCTCTCTTTGGCAATGTGAATGTGACATACTTTCTCCGTGACATGAAAGCTTCTTCTGCATC
CGGAGATCATGAACTGAAGAAAGCCAAGAGGCCCAAGACAGACAAACCCATCACTAAACCATTGAACCAGCTACTAGAGC
AAGCACCGCCGGTTCACCAACCAAACATCCAGCTCAAGTCTTGTTTGAAAAAACCAGGCAATAACCGTAATGGTAACCAC
AGAACAGTACGAGTGAAATTCATGTTGGGTGAGAAAGAAACAGAGTCACCATTTTCGGTTTCGATTCTTCCTCTCTCTTC
ACAAGACTCAGAACCAAAGCCTGTAAATAACCAAGTGGACCACGTCGAGCCACCACTAGACCCGTCACAGCTTAAGGTGG
ACATCTCCCTGCAGATGATGGAGCTGTTAACAAGGTGTAACGATGCTGTGGCCAACGTCACGGGTTTGTTGGGTTACGTC
CCTTATCATTCCTTATGA