Details for Arabidopsis Locus AT3G05390

Position : Chr3 ( 5`- 1546443 .. 1548300 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05390

Protein [Map View]
MGRTCLPRWRLGRLMAGLQVILGLLVITVSLSCLYRFHSVGYFLQNEDTCNNIYTIKEVSSEGFDLKALHDRVDEVLEKM
DNLYEKLEKTVKDMEKSKDGSKKEMKKFLEDEVMKPFYYAHIGLRQIRLPKPEGIRNSTEKEEPLINKFLIEEIRQYITP
KENRVGKINMFGTERVYNTIGHACALMKMELEKYMDYDVGAYCDDDWNLAQKLMLNGCDPLPRRRCLTRASMTYQKPYPI
NESLWKLPDDRNVRWGNYQCRNFACLSSKNPKRGYTKCSGCFEMEKEKDKWVKNSSLLVDFMIEDVLRVKPSEIRIGLDY
GVGTGTFAARMREKNVTIVTTALNLGAPFNEMIALRGLIPLYISLNQRLPFFDNTMDMIHTTGLMDGWIDLLLMDFVLYD
WDRVLRPGGLLWIDRFFCKKKDLDDYMYMFLQFRYKKHKWAISPKSKDEVYLSALLEKPPRAI*

DNA
ATGGGAAGAACATGTTTGCCGAGATGGCGATTAGGAAGACTAATGGCAGGATTACAAGTCATCTTAGGATTACTGGTGAT
CACTGTGAGCCTCTCATGTCTCTACCGATTCCATTCCGTGGGTTACTTCTTGCAAAACGAAGACACTTGCAACAATATCT
ACACAATCAAAGAAGTCAGCAGCGAAGGATTCGACCTAAAGGCGCTGCACGATCGTGTTGATGAAGTACTAGAAAAGATG
GACAACTTGTACGAGAAGCTAGAGAAGACGGTAAAAGATATGGAGAAGAGCAAAGACGGAAGCAAAAAGGAGATGAAGAA
GTTTCTTGAAGATGAAGTGATGAAGCCATTTTATTATGCTCATATCGGATTAAGGCAAATCCGGTTGCCAAAACCCGAAG
GAATCAGAAACTCAACGGAAAAGGAAGAGCCTTTGATCAATAAGTTTCTCATTGAAGAGATAAGGCAGTACATTACACCA
AAGGAGAATCGTGTTGGGAAGATAAACATGTTTGGAACAGAGAGAGTTTACAACACTATTGGTCATGCTTGTGCGTTGAT
GAAGATGGAGCTAGAGAAGTATATGGATTATGACGTTGGAGCGTATTGCGATGATGATTGGAACTTAGCACAGAAGCTGA
TGCTTAACGGGTGTGATCCGTTACCTAGAAGACGATGCTTGACAAGAGCATCAATGACTTACCAAAAACCTTATCCGATC
AATGAGTCACTGTGGAAGCTTCCTGATGATAGAAATGTAAGATGGGGAAATTATCAATGCAGGAACTTCGCGTGCTTATC
AAGCAAGAACCCGAAAAGGGGTTACACGAAATGCAGCGGATGTTTTGAAATGGAGAAAGAGAAAGATAAATGGGTCAAGA
ACAGTAGTTTGTTAGTTGATTTTATGATTGAAGATGTTCTGAGAGTGAAGCCAAGTGAGATCAGGATTGGATTGGATTAT
GGTGTTGGGACAGGAACATTTGCAGCAAGAATGAGAGAGAAGAATGTGACTATTGTCACAACAGCTTTGAATTTGGGAGC
TCCTTTCAATGAGATGATTGCTTTGAGAGGTTTGATCCCATTGTACATATCTTTGAACCAGAGGCTACCGTTCTTCGATA
ATACAATGGATATGATTCACACTACCGGGTTAATGGATGGTTGGATCGATCTTCTTCTGATGGATTTCGTGTTATATGAT
TGGGACCGAGTGCTGAGACCGGGAGGGTTACTGTGGATTGATAGATTCTTCTGTAAAAAGAAGGATCTTGATGATTACAT
GTACATGTTCCTGCAGTTTAGGTACAAGAAACACAAGTGGGCTATTTCACCTAAATCCAAGGATGAGGTTTATCTCTCTG
CATTGCTTGAGAAACCTCCTCGTGCAATTTAA