Details for Arabidopsis Locus AT3G05380

Position : Chr3 ( 5`- 1539527 .. 1546469 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05380

Protein [Map View]
MAPVRKSRSVNKRFTNETSPRKDAGKSKKNKLRKKKLSDKLGPQWTRLELERFYDAYRKHGQEWRRVAAAIRNSRSVDMV
EALFNMNRAYLSLPEGTASVAGLIAMMTDHYSVMEGSGSEGEGHDASEVPRKQQKRKRAKPQRSDSPEEVDIQQSIGSPD
GCLTFLKQARANGTQRHATGKRTPRVPVQTSFMRDDREGSTPPNKRARKQFDANDDVAHFLALALTDASRRGGSPKVSES
PNRRTELSDSSPIKSWGKMSRTRKSQSKHCGSSIFEEWMESSRERKLDSDKDTTLLMDMERAGEMEAPRKGKRVYKKRVK
VEEAECNDSDDNGEACSATQGLRSKSQRRKAAIEASREKYSPRSPKKRDDKHTSGAFDALQALAELSASMLPANLMESEL
SAQLKEERTEYDMDEKSSTPEATSTSSHGEKANVEPDDSLLHAISSVENANKRKSKPSRLVSTDCDDVPTGKLQPQTSGS
LRKRKPKVLGDEAPAEFSQNKSINKKELPQDENNMKSLVKTKRAGQVPAQSKQMKTVKALEESAITSDKKRPGMDIVASP
KQVSDSGPTSLSQKPPNRRKKSLQKSLQEKAKSSETTHKAARSSRSLSEQELLLKDKLATSLSFPFARRRCIFEWFYSAI
DHPWFSKMEFVDYLNHVGLGHIPRLTRLEWSVIKSSLGRPRRFSERFLHEEREKLKQYRESVRKHYTELRTGAREGLPTD
LARPLAVGNRVIAIHPKTREIHDGKILTVDHNKCNVLFDDLGVELVMDIDCMPLNPLEYMPEGLRRQIDKCLSMKKEAQL
SGNTNLGVSVLFPPCGLENVSFSMNPPLNQGDMIAPILHGKVSSNTSSPRQTNHSYITTYNKAKEAEIQRAQALQHALDE
KEMEPEMLEIVKGSKTRAQAMVDAAIKAASSVKEGEDVNTMIQEALELVGKNQLLRSSMVKHHEHVNGSIEHHHNPSPSN
GSEPVANNDLNSQDGSEKNAQMPSELITSCVATWLMIQMCTERQYPPADVAQLIDAAVTSLQPRCPQNLPIYREIQTCMG
RIKTQIMSLVPT*

DNA
ATGGCACCAGTTAGGAAGTCGAGGAGTGTGAACAAGCGTTTCACCAATGAAACTTCCCCAAGAAAAGATGCTGGGAAATC
GAAAAAAAATAAGCTACGTAAGAAGAAATTGTCTGACAAGCTGGGACCTCAGTGGACCAGATTAGAACTTGAGCGTTTCT
ATGATGCTTACCGCAAGCACGGACAAGAGTGGAGAAGGGTGGCTGCTGCAATTCGGAATAGCAGGTCTGTTGACATGGTG
GAAGCTCTATTTAATATGAATCGGGCGTATTTATCTCTCCCCGAGGGAACTGCCTCTGTAGCTGGCCTTATTGCGATGAT
GACAGATCATTACAGTGTCATGGAAGGGAGTGGCAGTGAAGGAGAAGGCCATGATGCTTCAGAAGTACCAAGGAAACAAC
AAAAGCGCAAACGTGCTAAACCTCAACGTAGCGATTCTCCAGAGGAAGTGGATATACAACAGTCAATTGGTTCACCAGAT
GGATGCCTCACGTTTTTGAAGCAAGCACGAGCTAATGGAACTCAGCGACATGCCACTGGAAAACGTACACCACGGGTTCC
TGTACAAACTTCATTTATGAGGGATGATAGAGAAGGCTCTACTCCACCAAATAAAAGAGCCAGGAAGCAATTCGATGCCA
ATGATGATGTAGCACATTTTTTAGCGTTAGCATTAACAGATGCATCGAGAAGGGGAGGGTCTCCAAAAGTTTCTGAATCA
CCAAATAGAAGAACAGAACTTAGCGATAGCTCACCGATAAAGAGCTGGGGGAAAATGTCGCGAACCAGAAAATCTCAGTC
TAAGCACTGTGGCAGCTCCATTTTCGAGGAGTGGATGGAAAGTAGCCGAGAAAGGAAACTTGACTCTGATAAAGATACTA
CCTTGTTGATGGATATGGAAAGGGCTGGCGAAATGGAGGCTCCGCGGAAGGGGAAAAGAGTCTACAAGAAAAGAGTGAAA
GTCGAAGAAGCAGAATGTAATGATTCTGATGACAATGGAGAAGCATGCAGTGCCACACAAGGGCTCAGAAGTAAATCACA
AAGACGAAAGGCTGCTATTGAAGCCTCAAGAGAGAAATACTCACCGCGCAGCCCAAAGAAAAGAGATGACAAACATACTT
CCGGAGCTTTTGATGCCCTGCAAGCATTGGCCGAATTGTCAGCTTCAATGCTTCCAGCAAATTTGATGGAGTCAGAATTA
TCTGCTCAGTTGAAGGAAGAAAGAACAGAATACGACATGGACGAGAAATCTAGCACACCAGAAGCTACTTCCACAAGCAG
TCATGGGGAAAAAGCAAATGTAGAGCCAGATGATAGTCTCCTTCATGCAATTTCTTCTGTTGAGAATGCTAACAAGAGAA
AGTCAAAACCTTCAAGGCTGGTATCCACTGATTGTGATGATGTTCCCACAGGGAAGCTACAACCACAAACTAGTGGCAGT
TTAAGAAAACGTAAACCAAAGGTACTAGGGGATGAAGCTCCAGCAGAGTTTAGTCAGAACAAATCCATAAACAAGAAGGA
ATTGCCTCAAGATGAGAATAATATGAAGTCTTTGGTTAAAACAAAACGCGCTGGTCAAGTTCCGGCTCAGTCAAAACAGA
TGAAAACTGTTAAGGCGTTGGAGGAATCTGCTATAACAAGTGATAAGAAAAGACCTGGGATGGATATAGTAGCGTCACCT
AAACAAGTTTCTGACTCGGGTCCAACCAGTTTATCGCAGAAACCTCCAAACAGGCGAAAGAAGAGTCTGCAGAAAAGCTT
ACAAGAAAAGGCTAAATCTTCTGAAACCACTCATAAAGCTGCACGTAGTTCCAGATCTCTTTCAGAACAAGAGTTGTTGT
TAAAGGATAAGCTTGCTACTTCTCTGTCGTTTCCCTTTGCACGTCGAAGGTGCATATTTGAATGGTTTTATAGTGCTATC
GACCATCCCTGGTTTTCAAAGATGGAGTTTGTCGATTACCTAAATCACGTGGGGCTTGGTCACATTCCAAGACTTACTCG
TCTTGAATGGAGCGTCATTAAAAGTTCTCTTGGTAGACCACGAAGATTCTCTGAGAGATTTTTACATGAAGAGCGGGAGA
AACTTAAACAGTACCGCGAATCTGTGCGAAAGCATTATACAGAGCTTCGAACGGGTGCTAGGGAGGGGCTTCCTACAGAT
TTGGCTCGGCCATTAGCAGTTGGGAACAGAGTCATTGCCATCCATCCCAAAACACGGGAGATTCATGATGGAAAAATTCT
CACTGTTGATCATAACAAATGCAATGTTCTCTTCGATGACTTGGGCGTTGAGTTGGTTATGGACATTGATTGCATGCCTT
TAAATCCACTGGAATACATGCCAGAGGGTCTAAGGAGGCAAATTGATAAGTGCTTGTCTATGAAGAAAGAAGCACAGCTA
AGCGGGAATACAAACCTTGGTGTGTCTGTGCTATTCCCTCCTTGCGGACTTGAAAATGTCAGCTTTTCCATGAATCCTCC
TCTGAATCAGGGTGATATGATTGCTCCCATTCTGCATGGTAAAGTATCAAGCAACACTAGTAGTCCACGGCAGACTAATC
ATTCATATATCACAACTTATAACAAAGCAAAAGAAGCTGAGATTCAACGGGCACAAGCGCTACAGCATGCTTTAGATGAA
AAGGAAATGGAGCCAGAGATGCTAGAAATTGTCAAGGGTTCAAAAACAAGAGCGCAAGCAATGGTGGATGCAGCTATAAA
GGCTGCATCATCTGTGAAGGAAGGGGAAGATGTGAACACAATGATCCAAGAAGCCTTAGAGTTGGTTGGCAAAAATCAGC
TATTACGCAGCTCTATGGTCAAACATCACGAGCATGTAAATGGCAGTATAGAGCATCATCACAACCCATCTCCTTCAAAT
GGATCAGAGCCTGTGGCTAACAACGATTTAAACTCACAAGATGGTTCAGAGAAAAACGCTCAAATGCCTTCAGAGCTTAT
CACCTCCTGTGTTGCCACTTGGCTCATGATTCAGATGTGCACGGAGAGACAGTACCCTCCAGCTGATGTCGCACAGCTTA
TAGACGCAGCAGTCACAAGCTTGCAGCCACGATGCCCACAGAACCTACCGATCTACAGAGAAATCCAAACGTGCATGGGA
CGGATCAAGACTCAAATCATGTCCCTTGTACCAACTTGA