Details for Arabidopsis Locus AT3G05345

Position : Chr3 ( 5`- 1522449 .. 1523889 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05345

Protein [Map View]
MECLRVFASVPKISFFSNSRYSTSQRFIPSCRGKNREDPLSSSSPYSILGVEPSCSSSELKAAFRAKVKQYHPDVNKDGS
NSDIMIRRIIQAYEMLTNYSRSEIIEGECLDPFDHPECEALDVFVNEVLCVGKRCSYPCFETASHVFSCDSSGTARAMSQ
GHGEDYRVQSAVNQCPRNCIHYVTPSQRIILEELLDSVVDKPYDCSAEAEFLYALIVKAKFENNRYQKPKKKQPESSGKH
VDWF*

DNA
ATGGAATGTCTTCGTGTATTTGCTTCGGTACCTAAAATCTCTTTCTTCTCCAATTCAAGATACTCAACTTCTCAGCGATT
CATTCCCAGTTGCAGAGGAAAAAACAGAGAGGATCCTCTCTCCAGCTCTTCACCGTACTCTATACTTGGCGTAGAGCCAA
GCTGCTCATCTTCCGAGCTAAAGGCAGCTTTTCGTGCCAAAGTGAAACAATACCATCCAGATGTAAACAAAGACGGAAGC
AACTCTGATATTATGATCCGTCGCATAATCCAGGCATATGAGATGTTAACAAACTATAGCCGGTCAGAGATAATTGAAGG
AGAATGCTTGGATCCTTTTGACCATCCAGAGTGCGAGGCACTTGACGTGTTTGTGAATGAAGTCCTATGTGTTGGAAAAA
GATGTTCATACCCATGCTTTGAAACAGCTTCTCATGTCTTCTCGTGTGATTCATCTGGGACAGCTCGAGCAATGTCCCAA
GGACATGGCGAAGATTACCGTGTACAGTCTGCAGTTAATCAGTGTCCGAGAAATTGTATACATTATGTCACACCATCACA
GAGAATTATTCTAGAAGAGTTACTTGACAGCGTCGTGGACAAACCTTACGATTGTTCCGCAGAAGCAGAATTTCTATATG
CTCTTATTGTGAAAGCTAAATTTGAGAACAATCGGTATCAGAAGCCAAAGAAGAAACAACCTGAATCTTCAGGAAAACAT
GTAGACTGGTTCTGA