Details for Arabidopsis Locus AT3G05340

Position : Chr3 ( 5`- 1523463 .. 1526166 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05340

Protein [Map View]
MNSRWVIQKLTSHLPSCLSTVLSPSKILIRQSPNYQVSTFLLNHVDMSLLLSICGREGWFPHLGPCLHASIIKNPEFFEP
VDADIHRNALVVWNSLLSLYAKCGKLVDAIKLFDEMPMRDVISQNIVFYGFLRNRETESGFVLLKRMLGSGGFDHATLTI
VLSVCDTPEFCLVTKMIHALAILSGYDKEISVGNKLITSYFKCGCSVSGRGVFDGMSHRNVITLTAVISGLIENELHEDG
LRLFSLMRRGLVHPNSVTYLSALAACSGSQRIVEGQQIHALLWKYGIESELCIESALMDMYSKCGSIEDAWTIFESTTEV
DEVSMTVILVGLAQNGSEEEAIQFFIRMLQAGVEIDANVVSAVLGVSFIDNSLGLGKQLHSLVIKRKFSGNTFVNNGLIN
MYSKCGDLTDSQTVFRRMPKRNYVSWNSMIAAFARHGHGLAALKLYEEMTTLEVKPTDVTFLSLLHACSHVGLIDKGREL
LNEMKEVHGIEPRTEHYTCIIDMLGRAGLLKEAKSFIDSLPLKPDCKIWQALLGACSFHGDTEVGEYAAEQLFQTAPDSS
SAHILIANIYSSRGKWKERAKTIKRMKAMGVTKETGISSIEIEHKTHSFVVEDKLHPQAEAIYDVLSGLFPVMVDEGYRP
DKRFILCYTGDDRNGTVS*

DNA
ATGAATTCGAGATGGGTGATTCAGAAACTGACCTCTCACCTTCCTTCTTGCTTATCTACCGTTTTGTCCCCTTCGAAAAT
CCTAATCCGGCAGAGCCCAAATTACCAAGTCTCGACCTTTCTCCTCAACCATGTCGATATGAGCCTTCTCTTATCCATCT
GCGGCAGAGAAGGCTGGTTTCCTCATCTGGGTCCTTGTCTCCACGCCTCCATTATCAAAAATCCTGAATTTTTCGAGCCT
GTAGATGCTGATATCCATCGAAACGCTCTGGTTGTTTGGAACTCTTTGCTTTCTCTGTATGCGAAATGTGGGAAGTTAGT
TGATGCCATTAAGTTGTTCGACGAAATGCCCATGAGAGACGTTATTTCGCAGAATATAGTGTTTTATGGGTTTCTGAGAA
ACAGAGAGACTGAGTCTGGTTTTGTATTGCTTAAACGAATGCTTGGGTCAGGTGGGTTTGATCATGCGACTTTGACGATT
GTTTTATCAGTGTGTGATACGCCAGAGTTCTGTTTGGTGACAAAGATGATTCACGCTTTAGCAATTTTAAGCGGTTATGA
CAAGGAAATTTCCGTGGGGAACAAACTGATCACATCTTATTTCAAATGTGGATGTTCAGTTTCTGGGAGAGGGGTTTTTG
ATGGGATGTCACATCGAAATGTCATCACTTTGACAGCTGTGATTTCGGGTCTGATAGAGAATGAGTTACACGAAGATGGT
CTAAGATTGTTTAGTTTGATGCGTAGAGGATTGGTCCATCCTAACTCAGTAACTTATTTGAGTGCTCTAGCTGCTTGTTC
TGGTTCACAGCGGATAGTGGAGGGGCAACAGATTCATGCCCTTTTGTGGAAATATGGGATTGAATCAGAATTGTGCATTG
AGAGTGCGCTAATGGATATGTACTCTAAATGTGGAAGCATTGAAGATGCGTGGACGATTTTCGAGTCCACGACGGAAGTT
GATGAAGTTTCCATGACTGTGATATTAGTTGGTTTAGCACAAAATGGGTCAGAGGAAGAAGCTATACAGTTCTTCATTAG
AATGCTTCAAGCTGGAGTAGAGATTGATGCAAATGTAGTCTCAGCTGTTCTTGGAGTTTCGTTTATCGATAATTCTTTGG
GTCTAGGCAAGCAACTGCATTCTTTGGTTATCAAACGAAAATTCTCCGGTAACACCTTTGTCAACAATGGACTCATTAAC
ATGTACTCAAAATGTGGAGATCTGACCGACTCACAAACTGTCTTTAGACGAATGCCGAAGAGGAACTATGTTTCATGGAA
CTCGATGATTGCAGCATTTGCTCGCCATGGTCATGGATTAGCTGCCTTGAAACTATACGAAGAAATGACTACGCTAGAAG
TGAAGCCTACAGATGTTACCTTTCTATCACTACTTCATGCTTGTAGCCATGTAGGGTTGATTGATAAAGGCCGAGAACTC
TTAAACGAGATGAAAGAGGTCCATGGAATCGAGCCCAGGACAGAGCATTATACCTGTATTATTGACATGTTGGGTCGAGC
TGGTCTTTTGAAAGAAGCAAAGAGCTTTATAGACTCATTGCCTTTGAAACCTGACTGTAAAATTTGGCAAGCGTTGCTTG
GAGCTTGTAGTTTCCATGGTGATACAGAAGTAGGGGAATATGCAGCTGAACAGTTGTTTCAAACTGCACCTGATAGCTCA
TCTGCTCATATCTTGATCGCTAACATATATTCATCCAGAGGAAAATGGAAGGAGAGGGCGAAGACGATCAAGAGAATGAA
AGCAATGGGAGTGACTAAAGAAACAGGCATAAGTTCGATTGAAATTGAGCATAAAACACACAGCTTTGTGGTTGAGGACA
AATTGCATCCACAAGCAGAGGCTATATATGATGTTCTGTCTGGATTGTTTCCGGTTATGGTAGATGAAGGTTACAGACCT
GATAAGAGGTTTATTCTGTGTTATACAGGAGATGACAGGAACGGCACGGTATCATAG