Details for Arabidopsis Locus AT3G05320

Position : Chr3 ( 5`- 1513450 .. 1514895 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05320

Protein [Map View]
MNSPLSSKNLRIFSKSVACKCLVLVGIALFYRALLLSYSPRNALSNSLLFRDRHMSDSSSTGGIRTDKFLEVPQIVWGLN
NQKIAFARACLTARMMNRTLLMPSLSASLFYKEVDKLRPIPFDKVFQFERFNSLCSGFVRLSRFSDVKNRAQVFDLEKGS
GRRWTVERDLEHLKQSARNESIDEFEVIRLIGKNPFLWHDHWPVEDYAKVFECMVVVDEISREADKVVMKIREAGEAERA
KLASKTEILGPVPFVAVHMRIEIDWMIHCKKLEQRKKISEICSSKREILDRVGNISGLKTPTVLYLAVADTLLEEKEEDS
SVLSGWRDGLIPFEKKKLGVKEEIYGKYSYLIQSAIDYEVCLRADVFVGNSFSTFSSLIVLERTQKARRLGFMSSCKDGG
NKWRSYAYNLAGESNGVPRRWMTNMTHSSLQAISYGSNSVSCSSG*

DNA
ATGAATTCTCCGTTAAGTTCTAAGAATCTGAGAATCTTTTCAAAGTCTGTTGCTTGCAAATGTCTTGTTCTTGTTGGTAT
TGCTCTGTTCTACAGAGCTCTGTTACTCTCTTACTCTCCCAGAAACGCTCTGAGCAATAGCTTATTGTTTCGAGATCGTC
ACATGTCAGATTCCTCCTCAACCGGTGGAATCCGAACTGATAAGTTTCTCGAGGTTCCTCAGATCGTCTGGGGACTAAAC
AATCAGAAGATAGCTTTTGCTAGAGCTTGCTTGACGGCAAGAATGATGAACAGAACGCTTCTCATGCCTAGTCTAAGTGC
TTCCTTGTTCTACAAGGAAGTTGATAAGCTTCGTCCCATTCCGTTTGATAAAGTGTTTCAGTTTGAAAGATTCAACTCTC
TCTGTTCAGGGTTTGTGCGGCTTTCTCGGTTCTCGGATGTTAAAAACAGAGCACAAGTGTTTGATCTAGAGAAAGGTAGT
GGAAGAAGATGGACGGTTGAAAGAGACTTGGAACACTTGAAACAATCCGCTCGTAACGAGTCCATCGATGAGTTTGAAGT
GATCCGTCTCATAGGGAAAAACCCGTTCTTGTGGCACGATCATTGGCCTGTTGAAGACTATGCTAAGGTCTTTGAGTGTA
TGGTGGTGGTTGATGAAATCTCAAGAGAAGCAGATAAGGTTGTGATGAAAATCCGAGAAGCAGGTGAGGCAGAAAGGGCA
AAACTCGCATCGAAAACCGAAATCCTCGGTCCGGTACCTTTTGTTGCGGTTCACATGAGAATAGAGATAGATTGGATGAT
ACATTGTAAGAAACTAGAGCAACGGAAAAAGATCTCAGAGATTTGTAGTAGTAAAAGAGAGATTTTGGACAGAGTAGGGA
ACATTTCAGGTTTAAAGACTCCAACAGTTCTTTACCTTGCAGTAGCAGATACTCTCTTAGAAGAAAAAGAAGAAGATTCA
TCGGTTTTAAGTGGTTGGAGAGACGGTTTAATACCATTTGAGAAGAAGAAGCTTGGGGTTAAAGAGGAGATATATGGGAA
GTATTCATATTTGATACAATCGGCTATAGATTACGAGGTGTGTTTAAGAGCGGATGTTTTTGTTGGTAATAGCTTTTCGA
CTTTCTCTAGTCTCATTGTTCTTGAGAGGACACAGAAAGCGAGAAGGTTAGGGTTTATGAGTTCTTGTAAAGATGGTGGA
AACAAGTGGAGATCTTATGCATATAATCTGGCTGGTGAATCAAACGGAGTTCCAAGGAGATGGATGACAAATATGACTCA
TTCGAGCTTGCAAGCTATTAGCTATGGCTCAAATTCTGTTTCTTGTTCTAGTGGATGA