Details for Arabidopsis Locus AT3G05310

Position : Chr3 ( 5`- 1510160 .. 1513301 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05310

Protein [Map View]
MWMGVGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVK
EVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQYREVETSIQWSA
QRLDQAKDVLYYAQKAVIDPVGPVFDQENNVLKPRCIAALKRIFLLSDHNMDGILSDEELNELQKKCFDTPLVPCEIKQM
KNVMQVTFPQGVNERGLTLDGFLFLNTRLIEEARIQTLWTMLRKFGYSNDLRLGDDLVPYSSFKRQADQSVELTNVAIEF
LREVYEFFDSNGDNNLEPHEMGYLFETAPESPWTKPLYKDVTEENMDGGLSLEAFLSLWSLMTLIDPPRSLEYLMYIRFP
SDDPSSAVRVTRKRVLDRKEKKSERKVVQCFVFGPKNAGKSALLNQFIGRSYDDDSNNNNGSTDEHYAVNMVKEPGVISD
TDKTLVLKEVRIKDDGFMLSKEALAACDVAIFIYDSSDEYSWNRAVDMLAEVATIAKDSGYVFPCLMVAAKTDLDPFPVA
IQESTRVTQDIGIDAPIPISSKLGDVSNLFRKILTAAENPHLNIPEIESKKKRSCKLNNRSLMAVSIGTAVLIAGLASFR
LYTARKQS*

DNA
ATGTGGATGGGTGTGGGAGATTCTAGTGGCTCGCCAAAACCGATAAGAATCGTTGTGGTTGGTGAAAAGGGCAGTGGAAA
ATCAAGCTTGATTATGGCTGCAGCAAGAAATACTTTCCATCCAAACATCCCTTCTCTGTTACCTTACACCAATTTACCTT
CTGAATTCTTCCCTGACCGTATTCCCGCTACTGTTATCGACACTTCTTCAAGACCGGAAGACAAGGGAAAGGTAGTTAAG
GAAGTTAGGCAAGCAGATGCAATTGTTTTGACATTTGCATTTGATAGACCGGAGACTCTTGACCGTTTGAGTAAATACTG
GCTTCCTCTGTTTCGACAATTAGAGGTGAGAGTTCCTATCATAGTGGCAGGTTATGAAGTTGATAACAAAGAGGCTTATA
ATCACTTCAGCATTGAACAAATAACATCAGCTCTGATGAAACAATATCGAGAGGTCGAGACATCTATCCAGTGGTCTGCT
CAGAGGCTAGATCAGGCTAAAGATGTTCTCTACTATGCACAAAAAGCGGTTATTGACCCAGTAGGACCTGTGTTTGATCA
AGAAAACAATGTACTGAAGCCTCGCTGTATCGCTGCCTTGAAACGTATCTTCTTACTCTCTGACCATAACATGGATGGTA
TTCTTAGTGACGAGGAGTTAAACGAGCTTCAGAAAAAATGCTTCGATACACCATTGGTGCCTTGTGAAATTAAACAAATG
AAAAACGTTATGCAAGTCACGTTTCCACAAGGAGTTAATGAAAGAGGACTCACATTGGATGGTTTCTTGTTTCTAAACAC
ACGTTTAATCGAAGAAGCAAGAATCCAAACACTATGGACTATGCTCAGGAAATTCGGGTATAGTAACGATCTAAGACTTG
GAGATGATCTAGTTCCTTATTCATCATTCAAACGCCAAGCTGATCAGAGTGTTGAGCTAACAAATGTAGCTATTGAATTC
TTAAGGGAAGTCTATGAGTTTTTCGACAGTAACGGTGACAATAACTTGGAACCTCATGAAATGGGATATCTCTTTGAAAC
TGCACCTGAAAGTCCTTGGACTAAACCTCTGTATAAGGATGTTACAGAGGAAAATATGGATGGAGGATTATCTCTTGAAG
CTTTCCTCTCACTGTGGTCATTGATGACACTAATTGATCCACCTAGGAGTCTGGAATATCTGATGTACATTAGATTCCCA
TCTGATGATCCATCTTCAGCGGTTCGCGTAACTAGGAAGCGAGTTCTTGATCGCAAGGAGAAGAAATCCGAAAGAAAAGT
TGTTCAGTGTTTTGTGTTTGGTCCCAAGAATGCTGGAAAGTCTGCATTGCTCAATCAGTTTATCGGAAGGTCATACGATG
ATGACAGCAACAACAACAATGGATCAACTGATGAACATTATGCTGTAAATATGGTTAAAGAACCTGGAGTGATTTCAGAT
ACAGATAAAACTCTGGTGCTAAAGGAAGTTCGAATTAAAGATGATGGATTCATGTTATCAAAAGAAGCATTGGCTGCTTG
TGATGTAGCAATCTTCATCTATGATTCTTCTGATGAGTACTCGTGGAACAGAGCCGTTGACATGCTTGCTGAGGTTGCAA
CCATTGCCAAAGATTCCGGTTACGTGTTTCCCTGCTTAATGGTCGCAGCAAAAACTGATCTCGATCCATTCCCAGTGGCA
ATTCAAGAATCAACTAGAGTTACACAAGATATAGGGATTGATGCTCCAATACCAATCAGCTCTAAATTGGGAGATGTCAG
TAACTTGTTTCGGAAGATCTTAACCGCGGCAGAGAATCCCCATTTGAATATTCCAGAGATTGAGTCAAAGAAGAAAAGGA
GTTGCAAGCTAAACAACAGATCTCTAATGGCGGTTTCAATCGGGACAGCGGTTTTGATCGCCGGGCTGGCTTCTTTCCGT
CTCTACACCGCAAGAAAGCAGAGTTAA