Details for Arabidopsis Locus AT3G05290

Position : Chr3 ( 5`- 1505890 .. 1507702 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05290

Protein [Map View]
MGVDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISKGQVFSLYQGLGTKNFQSFIS
QFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTSEFGESKGLWKTLTEGSWADAFDG
LGISLLLTSNPAIQYTVFDQLKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKE
NETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRRTLFLTNTKGKLR
SP*

DNA
ATGGGTGTCGATTTGGAATCGGTGTCGGAAGCAACCTCGGGAGCTATTGGGTCGCTTCTGAGTACAACGATCTTGTATCC
TCTTGATACATGTAAATCAAAGTTCCAAGCCGAGGTTCGAGCTCGTGGTCAGCAAAAATACAGATATCTTTCCGATGTTA
TGTGGGAGGCAATTTCTAAAGGACAAGTCTTTTCACTGTATCAAGGCCTTGGAACTAAGAATTTTCAGTCTTTCATTTCT
CAGTTCATCTACTTTTATAGCTATAGCTATTTCAAGAGAGTTCATAGTGAAAGGACTGGTTCTAAATCAATTGGAACTAA
GGCTAATTTGCTCATTGCTGCTGCTGCTGGGGCTTGTACTTCTGTCTTAATTCAGCCTCTAGATACAGCTTCATCAAGGA
TGCAAACTAGTGAGTTTGGAGAATCAAAAGGGTTGTGGAAGACCTTAACAGAGGGTTCATGGGCAGACGCATTTGATGGC
CTAGGGATCTCTCTTTTATTGACTTCAAATCCTGCAATTCAGTATACAGTGTTTGATCAGCTGAAACAGCACCTTCTTAA
GCAGAAAAATGCAAAAGCCGAGAATGGTTCTTCTCCGGTAGTGCTCTCTGCCTTTATGGCGTTTGTCTTAGGTGCGGTCT
CCAAAAGTGTTGCCACCGTGCTCACATATCCAGCAATCAGGTGCAAGGTGATGATTCAAGCTGCGGATGAGTCGAAGGAA
AACGAAACAAAGAAGCCGAGAAGAAGAACAAGGAAAACAATTCCAGGGGTTGTGTATGCCATATGGAGAAAAGAAGGAAT
GTTAGGGTTCTTTAAGGGCTTGCAGGCTCAAATCTTGAAGACTGTCTTGAGCTCAGCATTGCTATTGATGATCAAGGAGA
AAATCACAGCAACGACATGGATTCTCATTCTAGCTATCCGTAGAACCCTGTTTCTCACAAACACAAAGGGTAAGTTAAGA
AGTCCTTAG