Details for Arabidopsis Locus AT3G05250

Position : Chr3 ( 5`- 1495597 .. 1497469 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05250

Protein [Map View]
MAAKEIAGGSGSIDDGSDFDPCPICLGQFLRESYLDTCFHKFCFNCIKQWIKVVSSKASKQRSSVTCPLCKTENLSIIHN
YDGCSFERHYIDPNIPDGFVLTKEQRYRLQCYYTESGFLADVFDVARFWKLQKFLQPNRCLEAWLRRELQALMQEEDVDI
VLHHLVGVMESFCKRIKQRRKQETRSAETTNQEQFKAVVSEAARPFVMARTDRFVDELELFLAAGLNLEAYDAIYKQGLE
GNNRREIGAASEEREEVEEHNVRTRVTPYLFIFEEDSD*

DNA
ATGGCGGCGAAGGAGATCGCCGGCGGGAGCGGTTCTATTGACGATGGATCCGATTTTGATCCATGTCCTATTTGCCTTGG
ACAATTCCTCCGTGAATCCTACCTTGATACCTGTTTCCACAAGTTTTGTTTCAATTGTATAAAACAATGGATCAAAGTTG
TTTCAAGCAAGGCCTCTAAGCAACGTTCCTCAGTGACATGTCCTCTCTGTAAGACAGAGAATTTATCCATCATCCACAAC
TACGATGGATGTTCTTTTGAGCGGCATTATATCGACCCGAATATTCCAGATGGTTTTGTATTAACAAAAGAACAGAGATA
CAGGTTGCAGTGTTACTACACCGAATCAGGTTTCCTCGCCGATGTATTCGATGTTGCACGGTTTTGGAAGCTGCAAAAGT
TTCTCCAGCCGAACCGGTGCCTTGAAGCCTGGTTGAGGAGGGAGCTTCAAGCTCTGATGCAGGAGGAAGATGTTGATATT
GTTCTGCATCATTTGGTCGGTGTGATGGAATCCTTCTGCAAAAGAATCAAACAGAGACGCAAACAAGAAACAAGAAGCGC
AGAGACAACAAATCAAGAACAATTCAAAGCAGTTGTCTCAGAAGCAGCACGTCCATTTGTAATGGCGAGAACAGACCGAT
TTGTGGATGAACTTGAACTCTTTCTGGCCGCGGGACTAAACTTGGAGGCTTATGATGCAATCTATAAGCAGGGTTTAGAG
GGGAACAACCGAAGAGAGATCGGTGCAGCTAGTGAAGAAAGAGAAGAAGTGGAAGAACATAATGTAAGAACACGAGTGAC
TCCTTATTTGTTTATCTTCGAGGAAGACTCAGACTGA