Details for Arabidopsis Locus AT3G05240

Position : Chr3 ( 5`- 1493684 .. 1495381 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05240

Protein [Map View]
MMKKHYKPILSQLENCRSLVELNQLHGLMIKSSVIRNVIPLSRLIDFCTTCPETMNLSYARSVFESIDCPSVYIWNSMIR
GYSNSPNPDKALIFYQEMLRKGYSPDYFTFPYVLKACSGLRDIQFGSCVHGFVVKTGFEVNMYVSTCLLHMYMCCGEVNY
GLRVFEDIPQWNVVAWGSLISGFVNNNRFSDAIEAFREMQSNGVKANETIMVDLLVACGRCKDIVTGKWFHGFLQGLGFD
PYFQSKVGFNVILATSLIDMYAKCGDLRTARYLFDGMPERTLVSWNSIITGYSQNGDAEEALCMFLDMLDLGIAPDKVTF
LSVIRASMIQGCSQLGQSIHAYVSKTGFVKDAAIVCALVNMYAKTGDAESAKKAFEDLEKKDTIAWTVVIIGLASHGHGN
EALSIFQRMQEKGNATPDGITYLGVLYACSHIGLVEEGQRYFAEMRDLHGLEPTVEHYGCMVDILSRAGRFEEAERLVKT
MPVKPNVNIWGALLNGCDIHENLELTDRIRSMVAEPEELGSGIYVLLSNIYAKAGRWADVKLIRESMKSKRVDKVLGHSS
VETMF*

DNA
ATGATGAAGAAGCACTACAAACCAATTCTCTCTCAGCTAGAGAATTGCAGATCATTGGTGGAACTGAATCAACTCCATGG
TTTAATGATCAAATCCTCAGTTATCAGAAACGTCATTCCTCTAAGCCGACTCATAGATTTCTGCACTACTTGTCCTGAGA
CTATGAATCTCAGCTACGCGAGATCAGTTTTCGAAAGTATCGATTGTCCAAGTGTTTATATATGGAACTCTATGATCAGA
GGCTACTCAAACAGTCCAAATCCAGATAAAGCATTGATCTTTTACCAAGAAATGCTTCGAAAAGGTTATTCTCCGGATTA
TTTCACTTTTCCTTATGTTCTTAAGGCTTGTTCTGGGTTAAGGGATATTCAATTCGGGAGTTGTGTTCATGGGTTTGTTG
TGAAAACTGGGTTTGAAGTGAATATGTATGTTTCTACTTGCTTGCTTCATATGTATATGTGTTGTGGAGAAGTGAATTAT
GGTTTGAGAGTTTTTGAGGATATTCCTCAGTGGAACGTTGTTGCTTGGGGAAGTTTGATTTCTGGTTTTGTGAATAACAA
TCGGTTTAGTGACGCTATTGAGGCGTTTAGGGAGATGCAGAGTAATGGTGTGAAGGCAAATGAGACAATAATGGTGGATC
TTTTGGTTGCTTGTGGTAGATGTAAAGACATTGTGACTGGGAAATGGTTTCATGGGTTTCTTCAAGGATTAGGCTTTGAT
CCATATTTTCAGTCCAAAGTTGGATTCAATGTGATTTTGGCTACAAGTCTCATTGATATGTATGCTAAATGTGGAGATCT
GAGAACTGCGAGGTATCTGTTCGATGGAATGCCTGAGAGAACCTTGGTTTCTTGGAACTCCATCATTACAGGGTATAGTC
AGAACGGTGATGCAGAGGAAGCACTGTGTATGTTTTTGGATATGCTTGATTTGGGTATAGCTCCTGATAAAGTAACCTTT
TTGAGTGTTATCAGAGCTTCCATGATCCAAGGATGTTCACAATTGGGACAATCGATTCACGCTTATGTATCGAAAACCGG
CTTTGTGAAGGATGCTGCCATAGTTTGTGCACTTGTAAATATGTATGCTAAAACCGGTGATGCTGAGAGCGCAAAAAAAG
CGTTTGAAGATCTGGAGAAGAAAGATACAATAGCTTGGACCGTTGTGATCATTGGGTTAGCCAGTCACGGCCACGGGAAT
GAAGCATTGAGTATATTCCAGAGGATGCAAGAGAAAGGTAATGCTACACCTGATGGAATCACATATCTCGGGGTCTTATA
TGCGTGTAGCCACATAGGTTTAGTTGAGGAAGGACAGAGATACTTTGCAGAAATGAGAGATCTTCACGGCTTAGAACCAA
CAGTTGAACACTATGGATGTATGGTTGATATCTTGAGCCGTGCTGGTCGTTTTGAAGAGGCAGAGAGATTGGTAAAGACT
ATGCCGGTAAAACCCAATGTTAATATATGGGGTGCATTGTTAAATGGTTGTGATATACATGAAAATCTCGAGCTCACTGA
TCGGATAAGATCCATGGTTGCTGAGCCAGAAGAACTTGGTAGCGGAATCTATGTTCTTCTATCTAATATATACGCCAAAG
CTGGCCGATGGGCTGATGTTAAGCTAATTAGAGAATCCATGAAGAGCAAAAGGGTAGATAAAGTTTTAGGTCATAGTTCT
GTTGAAACAATGTTCTAA