Details for Arabidopsis Locus AT3G05230

Position : Chr3 ( 5`- 1492142 .. 1493619 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05230

Protein [Map View]
MHTFGYRANALLTFAVTALAFICAIASFSDKFSNQNPSAEIQILNINRFKKQSHGNDEVSLTLDISADLQSLFTWNTKQV
FVFVAAEYETPKNSLNQVSLWDAIIPAKEHAKFRIQVSNKYRFIDQGQNLRGKDFNLTLHWHVMPKTGKMFADKIVLPGY
SLPDAYR*

DNA
ATGCATACTTTTGGTTACAGAGCAAATGCTCTGCTCACTTTCGCAGTCACGGCTCTTGCTTTCATTTGCGCAATCGCGTC
CTTCTCAGACAAATTCAGCAACCAAAATCCTTCTGCTGAGATCCAGATACTTAATATCAATCGGTTTAAGAAGCAATCTC
ATGGTAACGATGAGGTCAGCTTGACACTGGACATATCAGCAGACTTGCAATCACTTTTTACTTGGAACACCAAACAGGTT
TTTGTTTTCGTAGCAGCAGAGTATGAAACCCCAAAGAATTCCCTGAATCAGGTTTCTCTATGGGATGCCATTATTCCTGC
CAAGGAACATGCCAAATTCCGGATTCAAGTCTCAAACAAGTACCGTTTCATCGATCAGGGACAGAATCTTCGGGGCAAAG
ACTTCAACTTGACATTACACTGGCATGTCATGCCCAAGACCGGGAAGATGTTTGCTGACAAGATAGTCTTGCCTGGTTAC
AGTTTACCAGATGCATACAGATGA