Details for Arabidopsis Locus AT3G05220

Position : Chr3 ( 5`- 1488595 .. 1491320 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05220

Protein [Map View]
MNKQDVMKLQTCVLKVNVHCEGCKHKVKKQLQKIEGVYSVKADVEQGRVTVTGNIDPALLVKKLSKSGKHAEILGGGGGG
GGGGGKGFPNLNGQFANLNMGGNNKPKGGKESNQVKGKAGGGGGGGQNHGHGQPMQLNPQQIQQMMMMKAAHGGGGGGQM
KMPPMAAKDQKKSVKFADDEDDEFSEDDYDDEDFSEDDYDDDEFDDDEDDDDEMGHGHGHGGGGGNHMPPNKMMMPNKMM
PQMGGHHGNGGGPKGPNEIMMMMNGFKGGGGGGKKGGGGGFEIPVQMKGMGEGKNGKDGKKGKGGEKGKKEGKENKGGGK
TGKTDAKSGGGGLLGFFKKGKSGNGDEKKSAGKKDGHGGNKVKSHGGGGGVQHYDSGPKKGGGGTKGGGHGGLDIDELMK
HSKGGGGGGNKGNHNHSAKGIGGGPMGPGGPMGPGGPMGQGGPMGMMGPGGPMSMMGPGGPMGPMGGQGGSYPAVQGLPM
SGGGGYYPGPPQASQQMNQQQYMQMMMNQQQQQQQQQQAVAHGGYGGGHGGDMYHPMMYARPYPAVNYAHPPPMPPPHSD
SYTHMFSDENPGSCSIM*

DNA
ATGAATAAACAAGATGTTATGAAACTTCAGACTTGTGTTCTGAAAGTGAACGTACACTGTGAAGGGTGTAAGCATAAAGT
GAAGAAACAATTGCAGAAAATCGAAGGTGTTTACTCTGTAAAAGCAGATGTAGAACAGGGGAGAGTTACTGTTACAGGGA
ACATTGACCCAGCTCTTCTGGTTAAGAAACTTAGCAAATCAGGCAAACATGCCGAGATCTTAGGCGGTGGTGGAGGAGGA
GGCGGCGGAGGTGGAAAGGGGTTTCCTAATCTGAATGGGCAATTTGCAAATCTCAACATGGGTGGAAACAATAAGCCTAA
AGGTGGAAAAGAGAGTAACCAAGTCAAGGGTAAAGCTGGTGGTGGCGGTGGAGGAGGTCAGAATCATGGACATGGTCAGC
CAATGCAATTGAATCCTCAACAGATTCAACAGATGATGATGATGAAGGCTGCTCACGGTGGTGGTGGTGGTGGTCAGATG
AAGATGCCGCCTATGGCAGCTAAGGATCAGAAGAAGTCAGTTAAGTTTGCTGATGATGAAGACGATGAGTTTAGTGAAGA
TGATTATGATGATGAGGATTTCAGTGAAGATGATTATGATGATGATGAGTTCGATGATGATGAAGATGATGATGATGAGA
TGGGTCATGGTCATGGACATGGAGGAGGTGGGGGTAATCACATGCCTCCTAATAAGATGATGATGCCTAACAAGATGATG
CCTCAGATGGGTGGTCATCATGGTAATGGTGGTGGACCTAAGGGTCCCAATGAGATAATGATGATGATGAATGGGTTCAA
AGGCGGAGGCGGTGGAGGAAAGAAAGGCGGTGGTGGCGGGTTTGAGATTCCGGTGCAGATGAAGGGAATGGGTGAGGGTA
AAAATGGAAAGGATGGTAAAAAGGGTAAAGGAGGAGAGAAGGGTAAGAAAGAAGGGAAAGAGAATAAAGGTGGGGGCAAA
ACCGGAAAAACAGATGCCAAAAGTGGTGGTGGTGGCCTTCTAGGGTTTTTCAAAAAGGGTAAAAGTGGGAACGGAGATGA
GAAGAAGAGCGCTGGGAAGAAAGATGGCCATGGGGGTAATAAGGTCAAATCTCATGGTGGGGGAGGAGGAGTTCAGCATT
ATGATAGTGGGCCTAAAAAAGGTGGTGGTGGGACCAAAGGAGGAGGCCATGGGGGCCTTGACATTGATGAGCTCATGAAA
CACAGCAAAGGAGGAGGAGGAGGAGGTAACAAGGGCAATCATAATCATAGCGCCAAAGGGATTGGTGGTGGCCCAATGGG
TCCAGGCGGTCCGATGGGTCCAGGCGGTCCGATGGGTCAAGGTGGTCCGATGGGTATGATGGGTCCAGGTGGTCCGATGA
GTATGATGGGTCCAGGCGGTCCTATGGGTCCAATGGGTGGCCAAGGCGGCTCTTACCCAGCGGTTCAAGGCTTGCCAATG
AGTGGAGGTGGAGGATATTATCCAGGGCCGCCTCAGGCAAGTCAGCAAATGAACCAACAACAATATATGCAAATGATGAT
GAACCAACAGCAGCAACAACAACAACAACAACAAGCTGTAGCTCATGGTGGCTATGGCGGTGGTCACGGTGGCGACATGT
ACCATCCGATGATGTACGCTCGGCCTTATCCTGCAGTTAATTATGCTCACCCTCCACCAATGCCGCCTCCTCACTCGGAT
TCTTATACTCATATGTTCAGCGATGAGAATCCAGGTAGTTGTAGTATTATGTGA