Details for Arabidopsis Locus AT3G05210

Position : Chr3 ( 5`- 1479538 .. 1482042 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05210

Protein [Map View]
MANEDDDGEKSRSLHQQIARKPKTQIVIGVPSYQEVLESSQTKSTPPSLFKPSQSFSQAFAFVKSSDVYSPPPPSSAAAS
SSQPSGASQVPHSSSQTHQTDGASSSSTPVATGSVPSNTTQNRNAILVSHRQKGNPLLKHIRNVKWVFSDIIPDYVLGQN
SCALYLSLRYHLLHPDYLYFRIRELQKNFKLSVVLCHVDVEDTVKPLLEVTKTALLHDCTLLCAWSMTECARYLETIKVY
ENKPADLIQGQMDTDYLSRLNHSLTSIRHVNKSDVVTLGSTFGSLAHIIDASMEDLARCPGIGERKVKRLYDTFHEPFKR
ATSSYPSVVEPPIPEAPVEKDVNSEEPVEEDEDFVEDSRKRKKKEPEPEKTVKTALSAVFARYSDRLSKKKEKQKEKDTT
TASDAETHQN*

DNA
ATGGCGAACGAAGACGACGACGGTGAGAAATCCAGAAGTCTGCACCAACAGATTGCTAGAAAACCCAAAACCCAGATCGT
GATTGGTGTGCCATCGTACCAGGAAGTTTTGGAAAGCTCACAGACGAAGTCCACGCCTCCATCTCTCTTCAAGCCTTCCC
AGAGTTTCTCTCAGGCTTTCGCTTTCGTCAAGTCGTCCGACGTCTACTCTCCTCCTCCTCCTTCCTCCGCAGCCGCCTCT
TCTTCTCAGCCGTCGGGCGCTTCTCAGGTGCCCCACAGTTCAAGCCAAACGCATCAAACTGATGGAGCCTCATCTTCTTC
TACTCCTGTAGCCACTGGCTCTGTACCATCAAACACAACTCAAAATCGTAACGCTATTCTCGTTAGCCATCGACAGAAAG
GAAACCCGCTTCTTAAACATATCAGGAATGTGAAATGGGTTTTCTCAGATATCATTCCAGATTACGTGCTTGGTCAAAAC
TCTTGCGCTTTGTATTTAAGCTTGCGGTATCATCTCCTACATCCGGATTACCTCTATTTCCGCATTAGGGAACTACAAAA
GAATTTCAAGCTAAGTGTTGTTCTTTGCCATGTCGACGTGGAAGATACGGTGAAACCGTTGCTTGAAGTCACAAAAACCG
CTCTACTTCATGATTGCACTCTATTGTGTGCCTGGAGCATGACAGAATGTGCCCGTTATTTGGAAACGATAAAAGTCTAT
GAAAACAAACCTGCAGATCTCATCCAAGGCCAAATGGATACAGATTACCTTTCACGGCTAAACCATTCTCTTACAAGCAT
TCGACATGTAAACAAGAGCGATGTAGTTACACTTGGTTCTACATTCGGGTCTCTTGCTCATATAATCGATGCATCCATGG
AAGATTTAGCACGTTGTCCCGGGATTGGCGAACGTAAGGTGAAGCGGTTGTATGATACATTCCACGAGCCTTTCAAGCGT
GCAACTTCGAGCTACCCGTCTGTTGTAGAACCACCAATCCCGGAAGCTCCAGTTGAGAAGGATGTGAACTCAGAGGAACC
TGTTGAAGAAGACGAGGATTTTGTGGAGGACTCGAGAAAACGCAAGAAGAAGGAGCCCGAGCCCGAGAAAACTGTGAAGA
CCGCACTCTCTGCTGTTTTTGCTCGTTACTCTGATAGACTTAGCAAGAAAAAGGAGAAACAGAAGGAGAAAGATACAACA
ACGGCGTCAGATGCTGAAACCCACCAAAATTAA