Details for Arabidopsis Locus AT3G05155

Position : Chr3 ( 5`- 1448570 .. 1451213 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05155

Protein [Map View]
MEGENSSIEKGLLLIRKEESANTTPFLVFTTFIIVSASFSFGVALGHTAGTMASIMEDLDLSITQFSVFGSLLTFGGMIG
ALFSATIADSFGCKMTLWITEVFCISGWLAIALAKNIIWLDLGRFFVGIGVGLLSYVVPVYIAEITPKTVRGTFTFSNQL
LQNCGVATAYYLGNFMSWRIIALIGILPCLIQLVGLFFVPESPRWLAKEGRDEECEVVLQKLRGDEADIVKETQEILISV
EASANISMRSLFKKKYTHQLTIGIGLMLLQQLSGSAGLGYYTGSVFDLAGFPSRIGMTVLSIVVVPKAILGLILVERWGR
RPLLMVM*

DNA
ATGGAGGGAGAGAATAGTAGCATTGAGAAAGGATTATTATTGATAAGGAAGGAAGAGAGTGCAAATACAACTCCATTTCT
TGTCTTCACCACTTTCATCATTGTCTCTGCTTCCTTCTCCTTTGGCGTTGCCTTAGGACATACTGCTGGTACAATGGCCT
CCATTATGGAAGATCTTGATCTTTCTATCACACAATTTTCTGTATTTGGTTCACTATTGACATTTGGAGGAATGATTGGA
GCACTATTTAGCGCCACAATTGCAGATTCATTTGGTTGTAAAATGACTTTGTGGATCACTGAGGTATTCTGCATAAGTGG
ATGGCTTGCAATTGCACTAGCCAAGAACATTATTTGGCTGGACTTGGGACGATTCTTTGTAGGAATTGGAGTTGGTCTCC
TTAGTTACGTGGTTCCTGTATATATCGCAGAAATAACTCCTAAAACTGTGCGAGGCACTTTTACATTTAGTAATCAGTTA
TTGCAAAATTGTGGAGTCGCAACGGCGTATTACCTTGGAAATTTCATGTCATGGAGAATAATAGCCTTAATAGGCATACT
TCCATGCTTGATACAACTTGTTGGGTTGTTTTTCGTCCCCGAATCTCCAAGATGGTTGGCAAAAGAAGGTCGTGACGAAG
AATGTGAGGTTGTTCTTCAGAAACTAAGAGGAGATGAAGCGGATATTGTGAAGGAAACTCAAGAAATCTTGATTTCTGTT
GAGGCTTCTGCGAATATCAGCATGCGTAGTCTTTTCAAAAAGAAATATACTCATCAACTTACAATTGGTATAGGTTTGAT
GCTTCTGCAACAGTTAAGTGGGAGTGCAGGATTAGGTTATTACACTGGTAGCGTATTTGATCTTGCCGGATTTCCTTCTC
GGATTGGGATGACGGTGTTGTCTATTGTCGTGGTACCAAAAGCTATATTGGGTCTGATACTTGTGGAACGATGGGGAAGA
AGACCGCTTCTTATGGTTATGTAA