Details for Arabidopsis Locus AT3G05140

Position : Chr3 ( 5`- 1435698 .. 1438341 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05140

Protein [Map View]
MNSASAHDLRLLEVDKEKQDPKSPRGALEACLTRCSISSASSSSDDPPPNREAIDNADADTDVQCKNHRASSNWGKFFKL
WKRRSMKRLSSFPPLSGAAPPIIKQNKSADPNMNGMVLHDIYDFQSSLQNFSISDIEIATDNFSPENIIGRGGYADVYQG
ILPEGKLIAVKRLTKGTPDEQTAEFLSELGIIAHVDHPNTAKFIGCCIEGGMHLVFRLSPLGSLGSLLHGPSKYKLTWSR
RYNVALGTADGLVYLHEGCQRRIIHRDIKADNILLTEDFQPQICDFGLAKWLPKQLTHHNVSKFEGTFGYFAPEYFMHGI
VDEKTDVFAFGVLLLELITGHPALDESQQSLVLWAKPLLERKAIKELVDPSLGDEYNREELIRLTSTASLCIDQSSLLRP
RMSQVVELLLGHEDVVMTPREAKIKMMQRTYSEELLDSVEYNSTKYLGDLDRIREVALAS*

DNA
ATGAATTCTGCTTCAGCTCATGATCTAAGATTACTAGAGGTAGATAAAGAGAAGCAAGACCCCAAATCACCAAGAGGAGC
CCTCGAAGCCTGCTTAACTCGTTGCTCAATCTCTTCCGCTTCATCTTCATCTGACGATCCTCCTCCAAACAGAGAAGCTA
TCGACAATGCAGATGCAGACACAGACGTACAGTGCAAGAATCACAGAGCATCTTCTAATTGGGGAAAATTCTTCAAGCTA
TGGAAACGCAGATCCATGAAACGCCTCTCTTCCTTTCCTCCATTAAGTGGCGCCGCCCCACCGATCATCAAACAAAACAA
AAGTGCAGATCCAAACATGAATGGCATGGTCCTTCACGATATCTACGATTTCCAATCATCTCTCCAAAACTTCTCAATAT
CTGACATCGAAATTGCAACTGACAATTTCAGTCCAGAAAACATTATCGGTAGAGGCGGTTACGCCGATGTATACCAGGGA
ATTCTACCGGAAGGAAAGCTAATCGCTGTGAAACGTTTGACAAAAGGCACACCGGACGAGCAAACAGCTGAGTTTCTATC
GGAACTTGGGATTATTGCTCATGTTGATCATCCTAACACTGCCAAATTCATCGGTTGTTGCATCGAGGGTGGAATGCATC
TCGTGTTCCGGCTATCTCCTCTTGGAAGCTTAGGCTCTCTCCTCCATGGACCATCAAAATATAAGCTGACTTGGAGCAGA
CGTTACAATGTAGCGTTAGGAACAGCAGATGGACTAGTGTATCTTCATGAGGGTTGTCAAAGACGAATCATTCATCGAGA
CATCAAAGCTGATAATATTCTTCTCACCGAAGATTTTCAACCGCAGATTTGCGACTTCGGGTTAGCCAAATGGCTTCCCA
AGCAATTGACACACCATAACGTATCCAAATTTGAGGGAACATTCGGGTACTTTGCACCTGAATATTTCATGCACGGAATC
GTGGACGAGAAGACTGATGTTTTCGCTTTTGGAGTTCTCCTCTTGGAGCTCATAACCGGACATCCTGCCCTTGACGAGTC
TCAGCAGAGCCTTGTCTTATGGGCTAAGCCGTTGCTAGAGAGAAAAGCTATAAAAGAATTGGTGGATCCATCTCTTGGAG
ATGAGTATAACCGAGAAGAGCTTATCCGGTTAACTTCCACGGCTTCTTTATGCATCGATCAATCTTCTCTTCTACGACCC
CGGATGAGCCAGGTTGTGGAATTATTACTAGGCCACGAAGATGTCGTAATGACTCCAAGAGAAGCGAAGATAAAGATGAT
GCAACGAACGTATTCCGAAGAATTATTAGATAGTGTAGAATATAACTCCACTAAGTACTTGGGAGATCTTGATCGCATTC
GAGAGGTTGCTTTAGCCTCTTGA