Details for Arabidopsis Locus AT3G05130

Position : Chr3 ( 5`- 1433475 .. 1435379 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05130

Protein [Map View]
MAKKKASRNSNDTANDNRQQQHDQKAPETDKKATVLSRQSSMEEHDSSEEQFQNLKSLNAMLLKQAMEKRNQIDSLVQAK
DELETELARYCQEKTGLRDELDQVSDENFGLKFELDFVIVFVESQFREMCVGVDMLVKEKSDRESEIRVLKGEAIELTGK
VEIEKEQLRKVCDERDLIKNGFDLQHEEVNRLKECVVRLEEKESNLEIVIGKLESENERLVKERKVREEEIEGVKKEKIG
LEKIMEEKKNEIDGLKREIKVLLSEKNEMEIVKIEQKGVIEELERKLDKLNETVRSLTKEEKVLRDLVIGLEKNLDESME
KESGMMVEIDALGKERTIKESEVERLIGEKNLIEKQMEMLNVQSSDKGKLIDQLSREKVELEERIFSRERKLVELNRKAD
ELTHAVAVLQKNCDDQTKINGKLSCKVDQLSNALAQVELRREEADKALDEEKRNGEDLKAEVLKSEKMVAKTLEELEKVK
IERKSLFSAKNDLESQSESLKSENVKLEKELVELRKAMEALKTELESAGMDAKRSMVMLKSAASMLSQLENREDRLISEE
QKREIGTEPYAMELESIEKAFKNKEDIIEEMKKEAEIMKQSTEEAHKKQTFWTLVSSVTTVFAAASFAYAARAR*

DNA
ATGGCCAAGAAGAAAGCGTCGCGTAACAGTAACGACACCGCTAATGATAACCGACAACAACAACATGACCAGAAAGCACC
GGAGACTGACAAGAAAGCCACGGTACTTAGCCGTCAGTCTTCCATGGAAGAACACGATTCTTCGGAGGAGCAATTCCAGA
ATTTGAAGTCTCTTAATGCGATGCTTCTCAAACAAGCTATGGAGAAGAGAAACCAGATCGATTCGCTGGTTCAGGCCAAG
GATGAATTGGAGACCGAGTTAGCTCGTTATTGTCAGGAGAAGACTGGGTTGCGTGACGAGTTGGATCAGGTGAGTGATGA
GAATTTCGGGTTGAAGTTTGAATTGGATTTTGTTATTGTGTTTGTTGAGAGCCAGTTTAGAGAGATGTGTGTTGGAGTTG
ATATGTTGGTGAAGGAGAAGAGTGATAGAGAGAGTGAGATTAGGGTTTTGAAAGGGGAAGCGATTGAGCTTACGGGTAAG
GTTGAGATTGAGAAGGAACAGTTGAGGAAGGTTTGTGATGAGAGGGACTTAATCAAGAATGGGTTTGATTTACAGCATGA
GGAGGTGAATCGATTGAAGGAGTGTGTAGTTCGTTTGGAGGAGAAAGAATCCAATTTGGAGATAGTGATTGGGAAATTGG
AATCTGAAAATGAGAGATTGGTGAAGGAGAGGAAGGTGAGAGAAGAGGAGATTGAAGGGGTAAAGAAGGAGAAGATTGGT
CTGGAGAAGATAATGGAGGAGAAGAAGAATGAGATTGATGGATTGAAGAGAGAGATCAAAGTGCTTTTAAGTGAGAAGAA
TGAGATGGAGATTGTAAAGATTGAACAAAAAGGAGTAATCGAGGAGCTGGAGAGAAAGTTAGACAAGTTGAATGAGACTG
TGCGGAGTTTGACAAAGGAAGAGAAGGTTTTGAGGGATTTGGTTATCGGGTTGGAGAAGAATCTTGATGAGTCTATGGAG
AAAGAGAGTGGAATGATGGTGGAAATTGATGCATTAGGGAAAGAGAGGACAATCAAGGAATCTGAGGTTGAGAGGTTAAT
AGGAGAGAAGAATTTGATTGAGAAACAGATGGAGATGCTCAATGTACAGTCATCTGATAAGGGGAAGTTGATTGACCAGT
TGTCTCGGGAGAAAGTTGAGCTTGAGGAGCGTATTTTTAGTCGGGAGAGGAAGCTTGTTGAGCTGAATCGAAAGGCTGAT
GAGCTAACTCATGCTGTTGCTGTGCTGCAAAAGAATTGTGATGATCAAACCAAGATTAACGGTAAGCTTAGCTGCAAAGT
TGATCAGCTAAGCAATGCTCTTGCGCAAGTTGAGCTCAGGAGAGAAGAAGCTGATAAGGCACTTGATGAGGAGAAGAGAA
ATGGAGAGGATCTTAAGGCAGAGGTTTTGAAATCAGAGAAGATGGTTGCAAAAACTCTAGAAGAGCTTGAGAAAGTTAAG
ATTGAGCGTAAGAGTTTATTTTCAGCGAAGAATGATTTGGAGAGTCAATCTGAATCATTGAAAAGCGAAAATGTTAAACT
CGAAAAGGAGCTTGTAGAGCTCAGAAAGGCTATGGAAGCTCTGAAAACAGAACTAGAATCAGCTGGAATGGATGCAAAAC
GCAGCATGGTGATGCTAAAGAGTGCTGCATCTATGCTATCCCAATTAGAGAACCGAGAAGATAGATTGATTAGTGAGGAA
CAGAAGCGAGAAATTGGAACTGAACCCTATGCGATGGAGCTAGAGTCGATAGAGAAAGCTTTCAAAAACAAAGAGGACAT
AATCGAGGAAATGAAGAAAGAAGCTGAGATCATGAAGCAATCAACGGAAGAGGCACACAAGAAGCAGACCTTCTGGACTC
TCGTTTCGTCTGTAACAACGGTTTTTGCTGCTGCATCTTTTGCCTATGCCGCTAGGGCTCGTTAA