Details for Arabidopsis Locus AT3G05100

Position : Chr3 ( 5`- 1424093 .. 1426000 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05100

Protein [Map View]
MAFSSSSSSPAMQKGIFVSMPVLVLTVSFVAAVFFLLSSSFSSCSCPEALSSSPTDAVEASVGGSGGDVRFEDRISPTQD
DIEWVRDLIRSNGLHMQKNELRKGINPRTRDQQLADLIQYKGISHYEGDEANNHTALPCPGELLVEQHHSNYGEPWAGGR
DVFEFLAESSSLKPNSRVLEIGCGTLRVGLHFIRYLSPQHFHCLEKDELSLMAALRYELPSQGLLHKRPLIVRGDDMEFS
KFGSDTAYDLIYASAVFLHMPDKLVWTGLERLVDRLKPYDGRIFVSHNVKFCSRLGQDKCSQKLASLGLEYLGKQTHDSL
LFNHYEIWFGFRRFKT*

DNA
ATGGCGTTTTCCTCCTCTTCTTCTTCTCCGGCGATGCAGAAAGGAATCTTTGTCTCCATGCCTGTACTTGTTCTCACCGT
TTCCTTTGTAGCTGCTGTCTTCTTCCTCCTCTCTTCTTCTTTCTCCTCTTGCTCCTGTCCTGAAGCTTTATCTTCTTCCC
CGACCGACGCCGTTGAAGCTTCTGTCGGTGGAAGCGGTGGTGATGTGAGATTTGAGGACAGGATATCTCCGACGCAGGAT
GATATTGAGTGGGTTAGAGATCTGATTAGATCCAACGGTTTGCATATGCAGAAGAATGAGCTTCGTAAAGGGATTAATCC
TCGCACTAGAGATCAACAACTTGCAGATCTGATACAGTACAAGGGTATATCCCATTACGAAGGAGATGAAGCAAACAACC
ACACAGCTCTTCCATGTCCTGGTGAGTTACTAGTTGAGCAGCATCACAGCAACTATGGTGAACCTTGGGCAGGTGGGCGC
GATGTATTCGAGTTCTTAGCTGAATCATCCAGTCTTAAACCAAACTCTCGTGTTCTAGAAATTGGATGTGGCACGTTACG
CGTGGGTTTGCATTTCATTCGCTATCTTAGTCCCCAACATTTTCACTGCCTTGAAAAGGACGAGCTTTCTCTAATGGCTG
CTTTGAGGTACGAGCTTCCATCACAAGGACTTCTACATAAACGACCTCTTATAGTCAGAGGCGATGATATGGAATTCAGC
AAGTTTGGTTCAGATACAGCCTATGATCTGATATACGCAAGTGCAGTCTTTCTCCACATGCCTGATAAACTCGTGTGGAC
TGGACTCGAAAGATTAGTAGACAGGTTAAAACCTTACGACGGGAGAATCTTCGTGTCACATAACGTAAAGTTTTGTTCAC
GGTTAGGACAAGACAAGTGTTCTCAGAAGCTAGCAAGTTTAGGACTTGAGTATCTTGGAAAACAAACACATGATAGCTTG
CTGTTTAATCACTATGAGATCTGGTTCGGGTTTAGACGGTTTAAAACATAA