Details for Arabidopsis Locus AT3G05090

Position : Chr3 ( 5`- 1417893 .. 1423664 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05090

Protein [Map View]
MHRVGSAGSNGGSVRTRKEKKLTYVLNDANDTKHCAGINCLDVLKSSVSNDQSYLFTGSRDGTLKRWAFDEDATFCSATF
ESHVDWVNDAALAGESTLVSCSSDTTVKTWDGLSDGVCTRTLRQHSDYVTCLAVAAKNNNVVASGGLGGEVFIWDIEAAL
SPVTKPNDANEDSSSNGANGPVTSLRTVGSSNNISVQSSPSHGYTPTIAKGHKESVYALAMNDTGTMLVSGGTEKVLRVW
DPRTGSKSMKLRGHTDNVRVLLLDSTGRFCLSGSSDSMIRLWDLGQQRCLHTYAVHTDSVWALACNPSFSHVYSGGRDQC
LYLTDLATRESVLLCTKEHPIQQLALQDNSIWVATTDSSVERWPAEVQSPKTVFQRGGSFLAGNLSFNRARVSLEGLNPA
PAYKEPSITVPGTHPIVQHEILNNKRQILTKDAAGSVKLWDITRGVVVEDYGKISFEEKKEELFEMVSIPSWFTVDTRLG
CLSVHLETPQCFSAEMYSADLKVSGRPEDDKINLARETLKGLLGHWLAKKKHKPKPQVLASGDTLSVKDTKKNLSASKTE
ESSAASDPVYPPFEFSSVSPPSIITEGSQGGPWRKKITEFTGTEDEKDFPLWCLDAVLNNRLPPRENTKLSFFLHPCEGS
SVQVVTLGKLSAPRILRVHKVTNYVVEKMVLDNPLDSLAIDAASVSGGQPQPLFSGNGLLQSGLKPWQKLRPSIEILCNS
QVLSPDMSLATVRAYVWKKPEDLILNYRVAIAR*

DNA
ATGCACCGGGTTGGAAGTGCCGGCAGTAATGGCGGTTCTGTTCGCACTCGCAAAGAGAAAAAGCTTACTTATGTGTTAAA
TGATGCCAACGATACAAAGCATTGTGCTGGCATAAATTGCTTGGATGTGTTGAAGTCGTCTGTTTCTAATGATCAAAGCT
ACCTCTTCACTGGAAGTCGTGATGGTACACTCAAGAGATGGGCATTTGACGAGGATGCGACCTTCTGCTCAGCTACATTT
GAGTCTCATGTTGACTGGGTGAACGACGCTGCTCTGGCTGGTGAGAGCACTCTTGTTTCTTGTTCTTCAGACACTACGGT
CAAGACATGGGACGGTTTATCAGATGGAGTCTGTACGAGGACTCTCCGTCAGCATTCTGACTATGTTACTTGTTTGGCAG
TTGCGGCAAAAAATAATAATGTTGTTGCATCTGGTGGCCTTGGTGGGGAGGTTTTTATATGGGATATTGAAGCTGCTTTG
TCACCAGTTACCAAACCTAATGACGCTAATGAAGATAGTTCTTCAAATGGTGCAAATGGTCCTGTTACAAGTTTAAGAAC
TGTTGGTTCAAGCAACAATATCTCTGTGCAGTCATCTCCATCTCATGGGTACACACCAACAATTGCGAAAGGCCATAAGG
AGTCTGTGTATGCTTTGGCGATGAATGATACCGGAACGATGCTCGTTTCTGGTGGAACAGAAAAGGTTTTACGTGTCTGG
GACCCTAGAACCGGTTCAAAGAGTATGAAGCTGAGAGGGCATACAGATAATGTTAGAGTGCTGCTTCTGGACTCAACTGG
CAGGTTTTGCTTGTCTGGGTCGTCTGATTCTATGATAAGACTATGGGATCTAGGTCAGCAGCGATGTCTTCATACCTATG
CGGTGCATACAGATTCTGTTTGGGCGCTTGCATGCAACCCATCATTTAGTCATGTTTATAGCGGTGGAAGAGACCAATGT
TTATACTTGACAGACTTGGCAACAAGGGAGAGTGTTTTGCTGTGCACTAAGGAACATCCAATTCAACAATTAGCGTTGCA
AGATAATAGTATATGGGTTGCAACTACAGACTCCTCTGTAGAGAGATGGCCTGCCGAAGTACAGAGTCCTAAAACGGTCT
TTCAACGAGGTGGCTCCTTCTTGGCTGGGAATTTGTCTTTTAATAGGGCGAGGGTATCTTTGGAAGGACTAAATCCAGCC
CCTGCATACAAGGAGCCGTCAATAACTGTCCCAGGAACTCACCCGATTGTGCAACATGAGATTTTGAATAATAAAAGGCA
AATTTTAACCAAGGACGCAGCTGGCTCAGTGAAACTATGGGATATAACTAGGGGTGTTGTGGTAGAGGACTATGGAAAGA
TTTCATTTGAAGAGAAGAAAGAAGAACTGTTTGAGATGGTAAGCATTCCATCGTGGTTTACTGTGGATACACGACTTGGA
TGCTTATCTGTACATTTGGAGACTCCACAATGCTTCTCTGCTGAAATGTATTCAGCAGACCTTAAAGTTTCTGGGCGACC
TGAAGATGATAAGATTAATCTAGCTCGTGAAACACTGAAAGGCCTGCTGGGTCACTGGCTGGCAAAGAAGAAACACAAAC
CAAAACCCCAAGTTCTTGCCTCTGGAGATACTTTATCTGTAAAAGATACCAAAAAAAATCTAAGTGCATCAAAAACTGAA
GAGAGTAGTGCTGCAAGTGATCCGGTGTATCCTCCATTCGAGTTTTCTTCCGTCTCCCCTCCTTCCATCATAACTGAGGG
TTCTCAAGGAGGACCATGGAGGAAGAAGATAACCGAGTTTACTGGAACTGAAGATGAGAAGGACTTCCCATTGTGGTGCT
TGGACGCTGTCTTGAACAATCGGCTTCCACCTAGAGAAAATACAAAATTAAGCTTCTTCCTGCATCCATGTGAAGGTTCA
TCGGTGCAGGTGGTTACACTAGGGAAACTTAGTGCACCCCGGATCTTAAGAGTTCACAAGGTTACCAATTACGTTGTGGA
AAAGATGGTCCTTGACAATCCGTTGGATAGTCTAGCTATTGATGCAGCAAGTGTTTCAGGAGGACAACCTCAGCCACTGT
TTTCAGGAAATGGATTGTTACAGTCTGGATTAAAGCCTTGGCAGAAACTTAGACCTTCCATTGAGATCTTATGTAATAGC
CAGGTCTTATCTCCAGATATGAGTTTAGCAACTGTACGGGCATATGTATGGAAGAAACCTGAGGATCTGATTCTCAACTA
CAGAGTGGCTATAGCTAGATAA