Details for Arabidopsis Locus AT3G05050

Position : Chr3 ( 5`- 1408613 .. 1411803 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05050

Protein [Map View]
MGCVLGRPGSSGSVSGSRDEVSTRIESNRHQVNNVSVTKTETTESTSAVVVASASNGEEVRNHEDVVDQKKENGFVVTEA
KERKSKGERKRSKPPDPRRSNPPKNLLGEQVAAGWPSWLSEVCGEALSGWLPRKADSFEKIDKIGSGTYSNVYKAKDSLT
GNIVALKKVRCDVNERESLKFMAREILILRRLDHPNVIKLEGLVTSRMSSSLYLVFRYMDHDLAGLAASPEIKFTEQQVK
CYMKQLLSGLEHCHNRGVLHRDIKGSNLLIDDGGVLRIGDFGLATFFDASKRQEMTNRVVTLWYRSPELLHGVVEYSVGV
DLWSAGCILAELLAGRAIMPGRNEVEQLHRIYKLCGSPSEEYWKKIRLPSTHKHAHHKPLPQYKRRIREVYKDFSPEALS
LLDTLLALDPAERQTATDVLMSDFFTTEPLACQPSDLPKYPPSKEIDAKRRDEEYRRQREARKAQGESGRRMRPRERAPR
AMPAPEANAENQSNIDRMRMITHANAKSKSEKFPPPHQDGSLGFQVGSSRRLDPSEIPYSTNSFTSSYSKEPFQTWSGPL
APIGAPDSTTRRRNDINKERRMASKVKGKRIVV*

DNA
ATGGGTTGTGTATTGGGTCGACCCGGATCATCAGGATCAGTTTCTGGGTCTAGAGACGAAGTTAGTACTAGGATTGAGTC
TAATCGACATCAAGTTAACAATGTGTCTGTGACCAAAACCGAAACAACAGAGAGCACTAGTGCTGTTGTTGTTGCTTCTG
CTTCTAATGGTGAGGAAGTTAGGAATCATGAAGATGTTGTGGATCAGAAGAAAGAGAATGGCTTTGTTGTGACTGAGGCC
AAGGAGAGGAAATCGAAAGGCGAAAGAAAAAGGTCTAAGCCTCCTGACCCGAGACGGAGCAACCCGCCAAAGAATTTGCT
CGGTGAGCAAGTTGCTGCTGGATGGCCCTCGTGGTTGTCTGAAGTTTGTGGGGAAGCGTTAAGCGGATGGCTTCCAAGAA
AAGCGGATTCCTTTGAGAAGATTGATAAGATTGGATCAGGAACGTATAGTAATGTGTACAAGGCGAAAGATTCGCTGACA
GGAAACATTGTGGCTTTAAAGAAAGTGCGGTGTGATGTTAATGAACGGGAGAGTTTAAAATTTATGGCTAGAGAGATTCT
GATTTTGAGGAGATTGGATCATCCTAATGTCATTAAATTGGAAGGTTTGGTTACTTCGAGGATGTCGAGTAGTTTATACT
TGGTTTTCCGTTATATGGATCATGATTTAGCTGGTCTCGCCGCTAGCCCGGAGATAAAATTCACTGAGCAACAGGTTAAA
TGCTATATGAAGCAACTACTTTCAGGGCTCGAGCATTGCCATAACCGAGGAGTTCTACACCGTGATATTAAAGGATCAAA
CCTTCTTATAGATGACGGTGGAGTTCTTAGAATAGGTGATTTCGGGCTTGCAACGTTTTTTGATGCGAGTAAGAGGCAAG
AGATGACGAATCGGGTTGTTACTTTATGGTACAGATCACCAGAGCTTCTTCATGGTGTTGTTGAGTACAGTGTCGGAGTT
GATTTGTGGAGTGCTGGTTGCATTTTAGCTGAGTTATTAGCTGGTAGAGCGATAATGCCAGGTCGTAACGAGGTCGAGCA
GTTGCATAGGATATATAAGTTATGTGGATCGCCTTCAGAAGAATATTGGAAGAAGATTAGACTTCCTTCTACTCATAAGC
ATGCTCATCACAAGCCTTTACCACAGTATAAGAGAAGAATAAGAGAGGTTTACAAAGATTTCTCTCCTGAGGCGCTTTCT
CTACTCGATACGCTTCTAGCGCTCGATCCAGCTGAACGCCAGACAGCTACAGATGTGTTGATGAGTGATTTCTTCACGAC
GGAGCCATTGGCATGTCAACCTTCTGATCTCCCGAAATATCCTCCAAGTAAAGAGATTGATGCCAAGAGACGAGACGAAG
AGTATCGGAGACAAAGAGAAGCGCGCAAGGCCCAAGGAGAGAGCGGAAGAAGAATGAGACCCCGAGAACGAGCCCCAAGA
GCAATGCCGGCTCCTGAAGCCAACGCCGAGAACCAGTCTAACATTGATAGGATGCGTATGATCACACACGCGAATGCAAA
GAGCAAGAGCGAGAAGTTTCCTCCACCGCATCAAGACGGGTCACTCGGTTTTCAGGTGGGATCTTCAAGGCGACTGGATC
CATCAGAGATACCGTATAGCACAAACTCATTCACATCATCATACTCCAAAGAGCCATTTCAAACTTGGTCAGGCCCTTTG
GCTCCCATTGGAGCACCTGACTCAACCACAAGGAGAAGAAACGATATTAACAAAGAGAGAAGAATGGCTTCTAAGGTCAA
AGGCAAAAGAATCGTTGTTTGA