Details for Arabidopsis Locus AT3G05040

Position : Chr3 ( 5`- 1401271 .. 1408197 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05040

Protein [Map View]
MEDSNSTASNVARAILAVVDFSSTSDTRKSAVQFLDSVKSGDVRVLAKTSFHLVKKEWSSEIRLHAFKMLQHLVRLRWDE
LSPPECRGLVNLSIELMSEVANASENWPLKSQSAALVAEIVRREGPDRWQEIFTLLTSLSAQGPLQAELVLMTLRWLPED
ITIYNDDLEGDRRRLLLRGLTQSLPEILPLLYNLLERHFGAAMSEAGMQHFDLAKQHADVVIACLNAIVAYTEWAPVPDL
ARYGILSGCSFLLSSSDFRLHACEVFKLVCSRKRPSDASTAEFDSAISNLFQILTNASREFLCRSSSSSSVIDDNDYDFA
VCMCESMASLGSTNLQSISSDGGVMAVYLQQMLGFFQHFKLGLHFEALLFWLSLMRDLLPKPKAATYPSGGGSSTGGDDS
SSQVDSEKKKTLSLINDDISSAILDVSFQRMLKKEKVPTGIALSLGPLELWSDEFEGKGDFGPYRSKLLELIKLTASHKP
LISSTKISERVITLIKHLLASPAPLQHVAVMDSQQLALDCIVATLFDGSNEFAGGSSEVHYALRGIFEGLLQQLLSLKWN
EPELMKVHVHYLDAMGPFLKYFPDAVGSLINKLFELLTSLPHVVKDPATSTSRAARLQICTSFIRIAKAAEKSVLPHMKG
IADTMGYLAKEGTLLRGEHNILGEAFLVMASSAGAQQQQEVLAWLLEPLSQQWIQPEWQNNYLSDPMGLVRLCSNTSFMW
SIYHTVTFFEKALKRSGYRKSNLNTTSATTPASHPMAHHLSWMLPPLLKLLRVLHSLWSPSVFQTLPPEMRAAMTMTDAE
RYSLLGEANPKLSKGVSVYADGSFEGTKEGQAEASESDIRNWLKGIRDCGYNVLGLSTTIGETFFKCLDANYVAMALMEN
LQSMEFRHIRLFIHTFITYIVKSCPADMWESWLGVLLHPLFIHCQQALSSAWPGLLQEGRAKVPDLFGIQSGSDMKLEVM
EEKLLRDLTREIATLFSTMASPGLNTGVPVLEHSGHVGRVDMSTLTDLHAFRSNSMVGFLLNHKSVALPALQICLETFTW
TDGEATTKVCYFCGVVVLLAKLTNNVELREFVSKDMFSAVIRGLGMESNAINSPDLVNICREIFIYLSDRDPAPRQVLLS
LPCLTPNDLHAFEEATAKTSSPKEQKQLMRSLLLLGTGNNLKALAAQKSQNVITNVTARTRLPASAPETIGAGVLWDEEF
VQ*

DNA
ATGGAAGATAGCAACTCCACGGCAAGTAATGTGGCTCGAGCGATTCTCGCCGTCGTCGATTTCAGCTCCACGTCCGACAC
TCGCAAATCGGCGGTCCAATTCCTGGATTCTGTAAAATCTGGAGATGTCAGGGTTTTGGCAAAGACTTCTTTTCATCTTG
TGAAAAAAGAGTGGTCTTCAGAAATTCGTCTCCATGCTTTTAAGATGCTACAGCATTTGGTTAGACTACGATGGGACGAA
TTAAGTCCTCCGGAGTGCAGGGGTCTTGTTAATCTTTCTATCGAACTAATGTCAGAGGTTGCTAATGCAAGCGAGAATTG
GCCTCTTAAGAGTCAGTCTGCTGCCCTTGTAGCTGAGATTGTTAGAAGAGAAGGCCCTGATCGTTGGCAAGAGATATTTA
CTTTATTAACTTCATTGTCTGCTCAGGGCCCCTTACAAGCTGAATTGGTATTGATGACTCTTAGATGGCTTCCTGAAGAT
ATTACAATTTACAATGACGACTTGGAAGGTGACAGGCGTAGGCTATTGTTGCGGGGACTTACTCAATCGTTGCCTGAGAT
TTTGCCTTTATTGTATAATCTTCTTGAGAGACACTTTGGAGCTGCAATGAGTGAAGCTGGTATGCAGCACTTTGACTTGG
CAAAACAGCATGCAGATGTAGTTATAGCTTGCTTGAATGCCATCGTTGCATACACTGAGTGGGCTCCTGTTCCAGATCTT
GCCAGATATGGAATTCTTAGTGGGTGCAGCTTCTTACTTTCTTCTTCTGACTTCCGTCTTCATGCTTGTGAGGTTTTCAA
ACTCGTCTGCTCAAGAAAAAGACCCAGTGATGCTTCTACTGCAGAGTTCGATTCTGCAATTAGCAATTTGTTTCAGATTC
TGACGAATGCCTCCAGAGAATTCTTATGTAGATCCTCCTCAAGTTCTAGCGTTATAGATGACAATGATTATGATTTTGCT
GTATGCATGTGTGAGAGTATGGCCTCTTTAGGCTCAACTAACTTGCAAAGCATCTCTTCTGATGGTGGTGTTATGGCTGT
TTATCTTCAGCAGATGCTTGGCTTTTTCCAACACTTCAAGTTGGGCCTTCACTTCGAGGCACTTCTCTTTTGGCTGTCAC
TGATGCGGGATTTACTTCCAAAACCCAAGGCTGCGACTTATCCAAGTGGTGGGGGATCATCAACTGGCGGTGATGATAGT
TCAAGCCAGGTTGATAGTGAAAAGAAAAAGACTTTAAGTCTTATTAATGATGACATCTCGAGCGCTATACTGGACGTATC
TTTCCAGCGGATGCTCAAGAAAGAAAAAGTTCCTACTGGAATTGCTCTTTCGCTTGGGCCCCTAGAACTCTGGAGTGATG
AATTTGAAGGGAAGGGAGACTTTGGCCCGTACCGATCAAAGCTTCTAGAATTGATCAAGCTTACTGCTTCTCACAAGCCT
CTCATCTCCAGTACCAAAATATCTGAAAGGGTGATTACACTCATTAAGCACCTATTGGCTTCTCCAGCTCCTCTTCAGCA
TGTAGCAGTGATGGACAGCCAGCAATTAGCACTTGACTGTATTGTGGCAACGCTTTTTGATGGATCAAATGAGTTTGCTG
GTGGAAGTTCTGAAGTTCATTATGCATTACGTGGAATATTTGAGGGATTGCTTCAGCAGCTTCTCTCTTTGAAATGGAAT
GAACCAGAACTTATGAAAGTGCATGTCCACTATCTGGATGCAATGGGTCCCTTTCTCAAGTATTTTCCAGATGCAGTTGG
AAGTCTCATCAATAAATTATTTGAGCTTCTCACCTCTCTTCCACACGTTGTGAAGGATCCAGCTACTAGTACATCTAGAG
CTGCAAGATTGCAGATTTGCACATCTTTCATAAGAATAGCCAAAGCTGCAGAAAAAAGTGTTCTGCCTCACATGAAGGGT
ATTGCTGATACAATGGGGTACTTGGCAAAAGAAGGAACTTTACTCCGTGGGGAGCATAACATTCTGGGTGAAGCATTTCT
TGTTATGGCTTCCTCAGCAGGAGCTCAACAGCAGCAAGAAGTTCTGGCTTGGTTATTGGAACCATTGAGTCAACAGTGGA
TCCAACCAGAGTGGCAGAACAATTATCTATCAGACCCGATGGGTCTTGTTCGTTTATGCTCCAACACATCCTTCATGTGG
TCCATATACCACACTGTTACATTCTTTGAGAAAGCACTCAAGCGAAGTGGATACAGAAAAAGCAATTTGAACACGACCTC
TGCGACAACTCCAGCTTCACATCCTATGGCTCATCATCTTTCTTGGATGTTGCCACCCCTCTTAAAACTACTCCGTGTTC
TTCATTCCCTTTGGTCTCCCTCTGTATTTCAAACATTACCCCCAGAAATGAGGGCGGCAATGACAATGACTGATGCTGAG
CGATACAGTCTCCTTGGTGAAGCAAATCCTAAATTGTCAAAAGGCGTATCGGTTTATGCTGATGGGTCATTCGAAGGAAC
TAAGGAAGGACAAGCCGAGGCAAGTGAATCTGATATACGAAATTGGTTGAAAGGTATCCGAGATTGTGGATACAACGTGT
TGGGCCTATCAACAACCATCGGAGAGACATTCTTTAAATGCTTAGATGCTAACTATGTTGCAATGGCACTCATGGAAAAT
TTGCAGTCGATGGAATTCAGGCACATTCGGCTGTTTATTCATACCTTTATAACTTATATAGTCAAATCTTGTCCGGCGGA
TATGTGGGAGTCATGGCTGGGAGTGCTTCTGCACCCATTGTTTATACACTGTCAGCAAGCTCTCAGCTCCGCCTGGCCAG
GTCTTCTACAAGAGGGCAGAGCAAAGGTTCCGGACTTGTTTGGCATACAAAGTGGATCAGACATGAAACTTGAAGTGATG
GAGGAAAAACTGTTAAGAGATCTAACTCGGGAGATTGCGACTCTCTTTTCAACAATGGCTTCTCCTGGACTAAACACAGG
AGTTCCAGTTTTGGAACATTCAGGACATGTTGGTCGTGTGGACATGTCCACTCTCACGGATTTGCATGCGTTCAGATCCA
ACTCTATGGTGGGTTTCCTCTTGAATCACAAAAGCGTAGCTCTACCAGCACTGCAGATCTGTTTAGAAACTTTTACCTGG
ACAGATGGAGAAGCGACCACCAAAGTCTGTTACTTTTGTGGTGTTGTTGTTCTTCTAGCTAAACTAACAAATAACGTGGA
GCTCCGAGAATTTGTTTCAAAAGATATGTTCTCGGCAGTCATTCGTGGCTTGGGCATGGAGTCCAATGCCATTAACAGCC
CTGATTTAGTTAATATATGCCGTGAAATATTTATCTATCTCTCTGACAGAGACCCAGCTCCTCGCCAGGTTTTGCTTTCG
CTCCCGTGTCTCACTCCCAACGACTTGCATGCTTTTGAAGAAGCTACAGCCAAAACTAGCAGCCCCAAAGAACAAAAGCA
GCTTATGAGGAGCTTGTTGTTGCTAGGTACTGGGAACAACTTAAAAGCACTTGCTGCTCAAAAAAGTCAGAATGTTATCA
CCAATGTCACAGCAAGAACGCGGCTACCCGCAAGCGCTCCAGAAACAATTGGAGCGGGTGTTTTGTGGGATGAAGAGTTC
GTACAATGA