Details for Arabidopsis Locus AT3G05000

Position : Chr3 ( 5`- 1387175 .. 1388756 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G05000

Protein [Map View]
MGREVAESCVDTMLMEMVAMYSGRFYANKPELAARRIEAIGYQVGHQLSERYTMERPRFSDHLEAIKFICKDFWSEVFKK
QIDNLKTNHRGTFVLQDNKFRWLSRVSIDPSSENETQDPSTPGESKAAQAVSMYLYFPCGIIRGVLSNLGIPCAVSADIS
SLPTCSFVIRVKA*

DNA
ATGGGGAGAGAAGTGGCGGAGAGCTGTGTAGACACTATGTTAATGGAGATGGTGGCGATGTACAGTGGCCGATTCTATGC
TAACAAGCCGGAACTCGCCGCTCGGAGGATCGAGGCCATTGGTTATCAGGTCGGCCACCAGCTCTCCGAGAGGTACACTA
TGGAAAGACCAAGGTTCAGTGACCATCTAGAGGCAATCAAGTTTATCTGCAAAGACTTCTGGTCTGAGGTCTTCAAGAAG
CAGATTGATAATTTAAAGACAAATCACCGGGGTACTTTTGTATTACAAGACAACAAGTTCCGGTGGTTGTCTCGTGTCTC
AATTGACCCTTCATCTGAGAATGAAACCCAAGATCCTTCTACTCCAGGGGAAAGCAAAGCTGCACAAGCGGTGAGCATGT
ACCTCTATTTCCCGTGTGGAATCATTAGAGGTGTCCTCTCCAACTTGGGGATACCTTGTGCTGTCTCTGCAGATATATCA
AGCCTTCCCACATGCTCTTTCGTGATTCGGGTCAAGGCTTGA