Details for Arabidopsis Locus AT3G04997

Position : Chr3 ( 5`- 1386498 .. 1386629 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04997

Protein [Map View]
MIRIKTELDYYERRSEQIRKKINDELLALNEANKSIVHIFTQF*

DNA
ATGATCCGAATCAAAACAGAGTTGGATTACTATGAGCGACGCTCTGAACAGATACGGAAGAAAATCAATGACGAACTCCT
TGCACTCAACGAGGCGAACAAGTCGATCGTCCATATTTTTACACAATTCTGA