Details for Arabidopsis Locus AT3G04970

Position : Chr3 ( 5`- 1376175 .. 1378500 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04970

Protein [Map View]
MAVQWLLVCHGMMTLTVVISFLCGQWPIFKGTPFQWIHYFLTFGAYDYFLRFVGFVFGSKGTDVILSVEYFCCDRPNPIL
QVIYIAIMGSTYFLTAKSSFIYIPGYYLGDVHKYTSFLAVIVGVILFLLTCFSDPGTVNAENVSRYISAYPYDDIIYSKK
ECSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLYGTVAIGFILAGRVKELRVVHIL
TVYYGVDKSFRSLAPRVIQWLVGTYNTQILLMVFLAIVSLLLAGFFAYHANLCLTNTTTNETFKWREYISLNKKLSEAKA
SAAALKAGMSCELKKPSAESKCFGLCGRSSAREEEVKADAIAKRNLYDRGSFQNVSEIVFPLSSRPSSSNKSKRKSE*

DNA
ATGGCGGTACAGTGGCTTTTGGTGTGTCACGGGATGATGACGTTGACGGTGGTCATCTCCTTCCTCTGTGGTCAATGGCC
AATCTTCAAAGGCACACCTTTTCAATGGATTCACTACTTCCTCACTTTCGGCGCCTACGATTACTTCCTGAGATTTGTCG
GATTTGTGTTTGGTTCCAAGGGTACGGACGTGATTCTTTCTGTGGAGTATTTCTGCTGCGATCGTCCTAATCCGATTCTG
CAAGTCATATATATAGCCATTATGGGATCAACCTACTTTTTGACTGCAAAATCTTCTTTCATCTATATACCTGGATATTA
TCTTGGCGATGTTCACAAGTACACAAGCTTTCTAGCTGTTATTGTTGGTGTCATACTTTTCTTATTAACATGCTTTTCTG
ATCCAGGTACTGTGAACGCTGAGAATGTTTCACGGTACATTTCTGCTTACCCCTATGATGATATCATTTACTCCAAGAAA
GAATGTTCTACGTGTAAAATCCCAAAGCCTGCTAGATCCAAGCATTGCAGCATCTGCAACCGCTGTGTGGCTCGGTTTGA
TCATCATTGTGGGTGGATGAATAACTGTATAGGAGAAAGGAACACCAAATATTTCATGGCTTTCCTCTTGTGGCATTTCC
TTCTTTGCTTGTACGGAACAGTTGCCATCGGATTTATTCTTGCTGGGCGAGTAAAAGAACTCCGTGTTGTACATATTTTA
ACTGTCTATTACGGTGTAGATAAATCTTTCCGAAGTTTAGCTCCTCGAGTTATACAGTGGCTAGTTGGTACATACAACAC
CCAAATTCTCCTAATGGTGTTTCTCGCCATTGTTTCTCTCCTCCTCGCTGGCTTCTTCGCTTACCATGCAAATCTCTGCT
TAACCAACACAACAACTAATGAGACGTTTAAGTGGAGAGAGTATATAAGCTTAAATAAGAAGCTCAGTGAAGCTAAGGCG
AGCGCTGCTGCTCTCAAGGCCGGGATGTCATGTGAACTAAAGAAGCCATCAGCTGAAAGCAAATGCTTCGGGCTTTGTGG
AAGATCCTCTGCCCGTGAAGAAGAAGTCAAAGCCGACGCTATAGCGAAACGGAATTTGTATGATAGAGGAAGTTTTCAAA
ACGTTTCTGAGATTGTTTTCCCTTTATCATCAAGACCATCTTCTTCCAACAAATCAAAACGAAAATCGGAATAG