Details for Arabidopsis Locus AT3G04943

Position : Chr3 ( 5`- 1368248 .. 1368678 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04943

Protein [Map View]
MKNSSLLFILIVVFVISSSENGIMIGEAKKCSNSWICEGDEKCKEKCMADYKGNGTCYYPSPPSKQHPEFFYPTCWCGFD
C*

DNA
ATGAAAAACTCTTCTCTTCTTTTCATACTTATTGTCGTTTTCGTTATTTCTTCTTCAGAAAACGGGATCATGATAGGAGA
AGCAAAAAAGTGTAGTAATTCATGGATTTGTGAAGGAGACGAGAAATGCAAAGAGAAGTGCATGGCTGACTACAAAGGCA
ATGGAACATGTTATTACCCATCTCCTCCTTCAAAACAACATCCTGAGTTCTTTTATCCTACATGCTGGTGTGGGTTTGAT
TGTTAA