Details for Arabidopsis Locus AT3G04930

Position : Chr3 ( 5`- 1362905 .. 1364799 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04930

Protein [Map View]
MTSDHRDALFSLELESPDPDEGGVADGGESDTDEDLRDNDDVVMPGTNEAEAEDDDPEEEDLNSPSTSSLPMVSTISATA
VVSGTPTATSSTGAVTVALPAGSAVPVSVIPVDSDPKWHRMTEIVHQRPPIDDSRRLFQRLWTDEDEIELLRGFLDYMTM
HRGSSSHPPDTAPFYEQIKSKLQLDFNKNQLVEKLRRLKKKYRNVMSKISSGKEVFFKSPHDQSTFEISRKIWNQTGKII
GFEDNNVMDFEETNNHHNTTNGNYSTFNSPSSNPTLELDSENGIEKKLTMSSSSVSRKRSRSRIGKIEEDNKPVITPSDG
PIASNVNLNEAAAVGIGGNLGGLIEETVKNCVSPVIKEMMNGTTSMMMAAMGGGFPGLGGGGGGGGGHGFGSLSPMFTRP
FNFGFGVEGGGNKAVADERWRKQQILELEVYSRRLELVQEQIRTTLNELKTMPSGI*

DNA
ATGACATCGGATCACCGCGACGCTCTTTTCTCTCTGGAACTGGAATCGCCTGATCCGGACGAAGGAGGTGTAGCAGACGG
AGGAGAATCTGATACCGACGAGGATTTGCGCGACAACGATGATGTTGTTATGCCGGGAACGAACGAAGCTGAAGCTGAAG
ACGACGATCCCGAAGAGGAAGATCTCAATTCTCCGTCTACATCATCACTCCCCATGGTTTCTACGATCTCAGCGACTGCT
GTTGTTTCCGGGACCCCGACGGCGACTTCCTCTACAGGCGCCGTGACCGTTGCACTTCCGGCTGGATCCGCCGTCCCTGT
CTCCGTGATTCCCGTTGATTCCGATCCGAAGTGGCACCGTATGACGGAGATCGTCCATCAGAGACCACCGATCGATGATT
CTAGACGCCTTTTCCAGAGGCTGTGGACAGACGAAGACGAGATCGAGCTTCTTCGTGGTTTTCTCGATTACATGACGATG
CACCGCGGAAGCAGCTCGCATCCGCCGGATACGGCGCCGTTTTATGAGCAGATAAAGTCGAAACTTCAGCTGGATTTCAA
CAAGAACCAGCTGGTGGAGAAGCTTCGGAGATTGAAGAAGAAGTACAGGAATGTGATGAGCAAGATCAGCTCTGGTAAAG
AGGTATTCTTCAAGAGCCCTCATGATCAGTCTACTTTCGAGATTTCTAGAAAAATCTGGAACCAAACTGGGAAAATCATA
GGCTTTGAAGATAACAACGTAATGGATTTCGAAGAAACCAATAACCATCATAACACCACCAATGGTAACTACTCAACCTT
TAACAGCCCTAGTTCTAATCCTACTCTGGAGCTCGACTCCGAAAATGGAATCGAGAAGAAATTGACAATGAGTAGCAGTA
GCGTGTCGAGAAAACGATCACGATCAAGAATTGGGAAGATTGAGGAAGACAACAAACCTGTCATCACTCCCTCTGATGGG
CCAATAGCTAGCAATGTCAACCTCAACGAAGCTGCAGCTGTTGGTATTGGAGGAAATCTCGGGGGTTTGATCGAAGAGAC
TGTGAAAAACTGTGTCTCTCCTGTGATCAAAGAGATGATGAATGGGACAACAAGTATGATGATGGCTGCAATGGGAGGAG
GGTTTCCGGGTCTTGGTGGTGGTGGTGGTGGTGGTGGTGGTCATGGTTTTGGCTCGCTAAGCCCCATGTTTACACGGCCG
TTCAATTTCGGTTTTGGTGTAGAGGGAGGAGGAAACAAGGCGGTTGCAGATGAGCGGTGGAGGAAACAACAGATTCTGGA
ATTGGAAGTGTATTCAAGGAGATTAGAGTTGGTTCAAGAGCAGATTAGAACGACATTGAACGAGTTAAAGACGATGCCGA
GTGGTATATGA