Details for Arabidopsis Locus AT3G04903

Position : Chr3 ( 5`- 1350510 .. 1350989 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04903

Protein [Map View]
MKSFLVAFLIVLVFFCVEMKIGNGFKIHEVPEPTGKWCGYSVPMKPCINDDRVKRCIAENTHGWLMATGMCTSIPSLKDC
YCMHQCP*

DNA
ATGAAGAGTTTTTTGGTAGCGTTTCTTATTGTGCTCGTCTTCTTCTGTGTTGAGATGAAAATAGGAAATGGATTCAAAAT
ACATGAAGTACCAGAACCCACAGGAAAATGGTGCGGATATTCGGTGCCGATGAAACCATGCATAAACGATGATCGCGTTA
AACGATGTATTGCGGAAAATACGCATGGCTGGTTGATGGCTACTGGCATGTGCACATCTATCCCAAGCTTAAAGGATTGT
TACTGTATGCATCAGTGTCCCTAA