Details for Arabidopsis Locus AT3G04900

Position : Chr3 ( 5`- 1349302 .. 1349928 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04900

Protein [Map View]
MEDLDFPICILKMNLQCCEDFPSRVKKLLRQVKGVYAITIDPVKGLILVCGTAEPSVLIKAVAKLGQSPQLYAYEKDPAT
AKTRFRTLLKRYATNKTQDKPSPPAPPVTATTPVETCPAGGETFRGFGYPGPTTMMQMPAFSLPPPRGLPGWLAPPTNPR
LKYEEPKVTPRKPPAPYPFDYYENLGFPPSDSLFNYFSDDNPQPCSIM*

DNA
ATGGAGGATTTGGATTTTCCGATTTGCATATTGAAAATGAATCTCCAGTGTTGTGAAGACTTCCCTTCACGGGTCAAGAA
GCTTTTGCGCCAAGTAAAAGGAGTTTACGCCATAACCATAGACCCGGTGAAGGGTCTGATTTTGGTCTGTGGCACAGCAG
AACCTTCGGTGCTTATCAAAGCCGTCGCAAAATTGGGGCAAAGTCCCCAACTTTACGCCTACGAGAAGGATCCAGCTACA
GCAAAGACCCGATTCCGCACCTTGCTTAAACGTTATGCCACCAACAAGACACAAGATAAACCATCCCCGCCTGCACCACC
TGTCACGGCAACCACCCCCGTGGAAACTTGTCCAGCAGGAGGTGAAACATTTAGAGGTTTTGGGTATCCTGGACCAACGA
CGATGATGCAGATGCCCGCCTTTTCGTTGCCCCCACCGAGAGGACTGCCGGGATGGTTAGCACCACCGACAAACCCGAGG
TTGAAGTACGAGGAGCCAAAGGTGACGCCGAGGAAGCCGCCTGCGCCTTATCCTTTCGATTACTACGAAAACTTGGGGTT
TCCACCATCCGACTCTCTTTTCAACTATTTCAGCGATGATAACCCTCAACCTTGCTCCATCATGTGA