Details for Arabidopsis Locus AT3G04890

Position : Chr3 ( 5`- 1347646 .. 1349202 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04890

Protein [Map View]
MAGVACQISISSSSTFRRVNQWPRCFSGSPEKKTPAVLKWAVSGVTEFLRLISGAPSSTSIATNKDRSKNEVTAGDVDDV
MGILRSDYRNFYFVTGVLTSAIYSDDCIFEDPTISFQGTELYERNLKLLVPFLEDASIELQNMEKSESSQRNYILATWKL
RTYLKLPWRPLISINGNTVYDLDKDFKALVFVQDCEACRELECLCARSNRADIHRQVFSLP*

DNA
ATGGCGGGAGTGGCTTGCCAGATATCTATCAGCTCATCTTCGACCTTTAGGAGGGTTAATCAATGGCCACGGTGCTTCTC
TGGTTCGCCGGAGAAGAAAACACCAGCTGTTTTGAAGTGGGCGGTTAGTGGAGTTACTGAATTTCTCCGGTTGATCTCCG
GTGCTCCGTCTTCAACCTCCATCGCTACAAATAAGGATCGATCAAAGAATGAGGTTACTGCTGGAGATGTCGATGATGTG
ATGGGGATTTTGAGATCAGATTATCGAAATTTCTACTTCGTCACTGGAGTCTTGACTTCTGCAATTTACTCGGATGATTG
CATCTTCGAGGATCCGACTATCAGCTTCCAGGGTACAGAGCTGTATGAACGCAACTTGAAGTTACTGGTTCCGTTCCTCG
AAGATGCATCCATTGAACTGCAAAATATGGAGAAGAGTGAGTCGTCCCAAAGAAACTATATACTAGCGACGTGGAAGCTA
AGAACTTACCTGAAGCTGCCATGGAGACCATTGATATCGATCAACGGGAATACGGTTTATGATCTGGATAAAGACTTCAA
AGCACTGGTTTTTGTACAAGATTGTGAGGCATGTCGAGAGCTGGAATGTCTCTGCGCTAGAAGCAATCGGGCAGATATTC
ACCGTCAAGTCTTTTCCCTTCCGTGA