Details for Arabidopsis Locus AT3G04880

Position : Chr3 ( 5`- 1346273 .. 1347377 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04880

Protein [Map View]
MAGAVSAVDQPLKIITGADDFGASLKDAMVTHLRSLGIDVEDTGVSSYYSAGSEVGRRVSASSSSEVRGLVCCGTGVGVA
MFANKFPGVYAATCLSVEDAVNARSISNCNVLAFSGIKTSPETALEIFDAWIKTPFKSPCPASGSEPWSSVISSFLDNSL
SEMSQIGKSTAGDSTTKKIDETTASCVICCLAKNREFTPVDIMPGGSMKIVRETPTSAIVRFKAGSVEPAHHHTFGHDLV
VIKGKKSVWNLSKKERADLVDGDYLFTPAGDVHRVKYHEDTEFFITWDGHWDIFLDEDLETAKKAIEEEA*

DNA
ATGGCCGGAGCTGTTTCTGCCGTCGATCAACCGTTGAAAATCATCACCGGAGCTGATGACTTTGGAGCGAGCCTCAAGGA
CGCGATGGTAACACACCTCCGCTCTCTCGGCATAGACGTGGAGGATACCGGAGTGTCCTCTTACTACTCTGCTGGATCTG
AAGTCGGTCGCCGCGTCTCCGCTTCATCGTCTTCCGAAGTTCGCGGCTTAGTCTGCTGCGGCACCGGCGTCGGAGTTGCG
ATGTTCGCCAACAAGTTCCCGGGCGTCTACGCAGCCACTTGTCTCTCCGTCGAAGACGCCGTCAACGCTCGATCAATAAG
CAATTGCAATGTCCTCGCATTCTCCGGCATCAAAACATCCCCGGAAACCGCCTTGGAAATCTTCGACGCTTGGATCAAAA
CTCCTTTCAAATCTCCTTGTCCTGCGTCCGGATCCGAACCATGGAGCTCAGTTATCTCTTCCTTCCTCGACAATTCTCTC
TCCGAGATGTCTCAGATTGGAAAGTCAACCGCCGGCGATTCAACAACCAAGAAGATCGATGAAACAACCGCGTCTTGCGT
AATTTGCTGCTTGGCGAAGAACAGAGAGTTCACTCCAGTGGACATCATGCCGGGAGGCTCGATGAAGATCGTTAGAGAGA
CGCCGACGTCGGCGATTGTAAGATTCAAAGCGGGAAGTGTGGAACCGGCGCATCACCACACATTCGGCCATGACCTTGTA
GTCATAAAGGGAAAGAAAAGTGTGTGGAATCTGAGCAAGAAGGAGAGAGCTGATCTCGTTGACGGCGATTACCTATTCAC
TCCCGCCGGTGATGTTCACCGAGTCAAATATCACGAAGACACTGAGTTCTTCATCACTTGGGATGGCCATTGGGACATAT
TCCTTGACGAAGACCTCGAAACTGCAAAGAAAGCCATCGAAGAAGAAGCTTGA