Details for Arabidopsis Locus AT3G04870

Position : Chr3 ( 5`- 1342608 .. 1346387 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04870

Protein [Map View]
MASSVVFAATGSLSVPPLKSRRFYVNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLDQGH
EVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFINKDGTIGELDFRFPVGA
PIHGIRAFLVTNQLKPYDKLRNSLALALSPVVKALVDPDGAMRDIRNLDSISFSDWFLSKGGTRASIQRMWDPVAYALGF
IDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIKQYITDRGGRIHLRWGCREILYDKSADGETYVTGLAIS
KATNKKIVKADVYVAACDVPGIKRLLPKEWRESRFFNDIYELEGVPVVTVQLRYNGWVTELQDIELARQLKRAVGLDNLL
YTPDADFSCFADLALASPADYYIEGQGTLLQCVLTPGDPYMRMPNDKIIEKVAMQVTELFPSSRGLEVTWSSVVKIAQSL
YREAPGKDPFRPDQKTPIKNFFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKLSSSATAVPDELSLV*

DNA
ATGGCTTCTTCAGTCGTCTTCGCGGCAACTGGGTCTCTCTCCGTTCCTCCATTGAAGTCTCGGAGATTCTATGTTAATTC
TTCACTCGACTCCGATGTTTCCGACATGAGTGTTAACGCTCCAAAGGGGTTATTTCCTCCAGAGCCTGTACCATACAAGG
GACCTAAGCTGAAAGTAGCCATTATAGGAGCTGGACTTGCAGGCATGTCGACTGCTGTAGAGCTTCTGGATCAGGGTCAC
GAGGTGGATATATATGATTCGAGGACATTCATTGGTGGCAAAGTGGGTTCTTTTGTAGATAGACGTGGGAACCATATTGA
AATGGGATTACATGTTTTCTTCGGATGCTACAACAATCTCTTCCGTTTGATGAAAAAGGTGGGTGCTGAGAAAAACCTTC
TAGTCAAAGACCATACTCATACATTTATAAACAAAGACGGCACAATTGGAGAGCTTGATTTTCGGTTTCCTGTTGGAGCT
CCAATCCATGGTATTCGCGCATTTTTGGTCACAAATCAACTCAAGCCCTATGACAAACTAAGGAATTCACTGGCTCTTGC
ATTAAGCCCTGTTGTTAAAGCTCTTGTCGACCCCGATGGAGCAATGAGAGACATTCGCAACCTTGACAGCATAAGTTTCT
CGGATTGGTTCCTGTCAAAAGGTGGGACACGGGCAAGTATCCAGAGAATGTGGGATCCTGTTGCTTATGCTCTAGGTTTC
ATAGACTGCGATAACATGAGTGCGCGATGCATGCTTACAATATTCTCATTATTCGCTACCAAAACAGAAGCTTCTCTGTT
GCGTATGCTCAAGGGCTCTCCTGATGTTTACTTGAGTGGTCCTATCAAACAATATATCACAGATAGAGGTGGCAGAATCC
ATCTAAGGTGGGGTTGCAGGGAGATACTTTATGATAAATCAGCAGATGGAGAAACTTATGTCACTGGACTAGCAATTTCT
AAGGCTACGAACAAGAAGATTGTGAAAGCTGATGTATATGTTGCAGCATGTGATGTGCCGGGAATCAAAAGGTTACTTCC
AAAAGAATGGAGGGAATCTCGGTTTTTCAACGATATATATGAACTCGAGGGAGTACCTGTGGTTACAGTACAGCTCAGAT
ACAATGGTTGGGTCACGGAGTTACAAGACATTGAACTTGCTAGGCAGTTGAAACGAGCGGTTGGCTTAGATAATCTTCTC
TACACTCCTGATGCTGATTTCTCGTGCTTTGCGGATCTTGCACTAGCTTCGCCTGCAGATTATTACATCGAAGGACAAGG
CACTTTACTTCAGTGCGTTCTAACACCAGGAGATCCGTATATGCGAATGCCAAATGATAAGATCATAGAGAAAGTAGCGA
TGCAGGTCACTGAGTTGTTTCCATCGTCACGAGGCCTAGAAGTCACTTGGTCGTCGGTTGTAAAAATCGCTCAGTCTCTG
TACCGTGAAGCACCCGGAAAAGATCCATTCAGACCCGATCAGAAGACGCCCATAAAGAATTTCTTCCTCGCCGGTTCATA
CACAAAGCAGGATTACATAGATAGTATGGAAGGAGCAACATTATCAGGGAGACAAGCTTCGTCATACATCTGTGATGCTG
GTGAAGAACTAGCAGAGCTAAACAAGAAGCTTTCTTCTTCTGCAACTGCAGTTCCTGATGAGCTAAGTCTGGTCTAA