Details for Arabidopsis Locus AT3G04860

Position : Chr3 ( 5`- 1339104 .. 1340623 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G04860

Protein [Map View]
MRDFPSCSGENGVQIADSSSSSSAGRNAQNLVICIYRCRIRGRTCLITVTWTKNLMGQCVTVGVDDSCNRSLCKVEIKPW
LFTKRKGSKTLEAYACNIDVFWDLSSAKFGSSPEPLGGFYVGVVVDKEMVLLLGDMKKEAFKKTNAAPSSSLGAVFIAKK
EHVFGKRTFATKAQFSGDGKTHDLVIECDTSLSDPCLIVRVDGKILMQVQRLHWKFRGNDTIIVNRISVEVLWDVHSWFF
GLPSSPGNAVFMFRTCQSVEKTWSFTQVPTSSKSQSFGFSLILYAWKNE*

DNA
ATGAGAGATTTTCCTTCTTGCTCTGGTGAAAATGGTGTTCAGATTGCGGACTCTTCGTCTTCCTCGAGCGCTGGAAGAAA
TGCTCAGAATTTGGTAATATGCATCTACCGTTGCCGCATCCGAGGTAGGACTTGCTTGATCACAGTCACATGGACTAAGA
ATCTGATGGGTCAGTGTGTTACCGTGGGGGTTGATGATTCTTGCAACCGAAGTCTGTGTAAAGTCGAGATTAAGCCGTGG
CTCTTCACTAAACGAAAAGGGTCCAAGACTCTAGAGGCGTATGCCTGTAATATCGATGTTTTCTGGGATCTCTCGTCTGC
TAAATTTGGATCCAGCCCTGAACCTTTAGGAGGGTTCTATGTTGGAGTTGTTGTTGACAAAGAGATGGTTCTTCTTCTTG
GTGATATGAAGAAAGAAGCTTTTAAAAAGACGAATGCTGCACCTTCTTCATCTTTAGGTGCTGTGTTCATTGCTAAGAAA
GAGCATGTCTTTGGCAAGAGAACGTTTGCAACTAAAGCTCAGTTTTCAGGTGATGGCAAAACTCATGATCTTGTGATCGA
GTGTGACACTAGTCTCAGTGATCCTTGTCTCATTGTTCGTGTCGATGGAAAGATCTTGATGCAAGTGCAGCGGCTTCATT
GGAAGTTCCGTGGCAACGATACCATAATTGTCAATAGAATCTCTGTGGAAGTTCTCTGGGATGTCCACAGTTGGTTCTTT
GGGTTGCCATCATCACCAGGAAATGCAGTGTTTATGTTCAGGACTTGTCAATCTGTTGAAAAGACCTGGTCTTTCACACA
GGTCCCCACGAGCTCAAAATCTCAAAGTTTTGGGTTTTCATTGATTCTGTATGCTTGGAAGAACGAGTAG